Rv3414c - alternative RNA polymerase sigma factor sigD

Expression: Most Significant Conditions for Rv3414c

Protein Domains

Gene Information
Locus	Rv3414c
Symbol	sigD
Gene Name	alternative RNA polymerase sigma factor sigD
Location	3833038 - 3833676 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:639 bp Protein:213 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	31481
Related Genes	CE0605 cg0696 DIP0577 jk1726 MAP4275 MAV_4359 Mkms_1181 Mmcs_1164 MSMEG_1599 MT3523 MUL_0897 Mvan_1508 nfa8890 nfa8920
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3414c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3414c Transcript 1
MVDPGVSPGCVRFVTLEISPSMTMQGERLDAVVAEAVAGDRNALREVLETIRPIVVRYCR
ARVGTVERSGLSADDVAQEVCLATITALPRYRDRGRPFLAFLYGIAAHKVADAHRAAGRD
RAYPAETLPERWSADAGPEQMAIEADSVTRMNELLEILPAKQREILILRVVVGLSAEETA
AAVGSTTGAVRVAQHRALQRLKDEIVAAGDYA*

Genomic Sequence

>Rv3414c
ATGGTCGATCCGGGAGTTAGCCCGGGATGTGTCCGCTTCGTAACGTTGGAGATATCGCCG
TCGATGACAATGCAAGGGGAACGTCTCGACGCTGTGGTTGCGGAGGCCGTGGCAGGAGAC
CGGAACGCGCTTCGGGAGGTGCTGGAGACCATCCGCCCGATCGTCGTGCGATATTGCCGA
GCGCGAGTCGGCACGGTCGAGCGGAGCGGCCTGTCAGCAGATGACGTGGCACAGGAGGTG
TGCTTGGCCACCATAACGGCGCTGCCGCGCTATCGGGACCGCGGCCGGCCATTCCTGGCG
TTTCTGTACGGCATCGCGGCGCACAAGGTTGCCGACGCCCATCGGGCAGCCGGCCGTGAC
CGGGCCTATCCCGCCGAAACGCTTCCTGAGCGCTGGTCAGCCGACGCCGGCCCGGAGCAG
ATGGCCATCGAGGCCGATTCGGTCACCCGGATGAACGAATTGCTTGAGATCTTGCCGGCC
AAGCAACGCGAGATCCTCATTCTGCGTGTTGTCGTCGGCCTGTCCGCGGAAGAGACCGCC
GCCGCCGTCGGCAGCACCACGGGGGCGGTCCGGGTGGCCCAACACCGTGCACTTCAGCGG
CTGAAGGACGAGATTGTTGCGGCAGGTGACTATGCGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3717	active	vijayachitra	2012-10-05
	EC. Hett, MC. Chao et al. A mycobacterial enzyme essential for cell division synergizes with resuscitation-promoting factor. PLoS Pathog. 2008
Interaction	Regulatory Rv3717	active	vijayachitra	2012-10-05
	HI. Boshoff, TG. Myers et al. The transcriptional responses of Mycobacterium tuberculosis to inhibitors of metabolism: novel insights into drug mechanisms of action. J. Biol. Chem. 2004
Interaction	Regulatory Rv3717	active	aparna.vchalam	2012-10-05
	EC. Hett, MC. Chao et al. A mycobacterial enzyme essential for cell division synergizes with resuscitation-promoting factor. PLoS Pathog. 2008
Interaction	Regulatory Rv3717	active	aparna.vchalam	2012-10-05
	HI. Boshoff, TG. Myers et al. The transcriptional responses of Mycobacterium tuberculosis to inhibitors of metabolism: novel insights into drug mechanisms of action. J. Biol. Chem. 2004
Interaction	Regulatory Rv3675	active	jhum4u2006	2012-10-05
	Co-expression (Functional linkage) authors,V. Makarov,G. Manina,K. Mikusova,U. Möllmann,O. Ryabova,B. Saint-Joanis,N. Dhar,MR. Pasca,S. Buroni,AP. Lucarelli,A. Milano,E. De Rossi,M. Belanova,A. Bobovska,P. Dianiskova,J. Kordulakova,C. Sala,E. Fullam,P. Schneider,JD. McKinney,P. Brodin,T. Christophe,S. Waddell,P. Butcher,J. Albrethsen,I. Rosenkrands,R. Brosch,V. Nandi,S. Bharath,S. Gaonkar,RK. Shandil,V. Balasubramanian,T. Balganesh,S. Tyagi,J. Grosset,G. Riccardi,ST. Cole Benzothiazinones kill Mycobacterium tuberculosis by blocking arabinan synthesis. Science 2009
Interaction	Regulatory Rv3675	active	jhum4u2006	2012-10-05
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	Regulatory Rv3647c	active	poorsekurdhanaraju	2012-10-05
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	Regulatory Rv1884c	active	swatigandhi19	2012-10-05
	Co-expression(Functional Linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	Regulatory Rv1815	active	swatigandhi19	2012-10-05
	Co-expression(Functional Linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	Regulatory Rv1884c	active	swatigandhi19	2012-10-05
	Co-expression(Functional Linkage) H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Regulatory Rv1815	active	swatigandhi19	2012-10-05
	Co-expression(Functional Linkage) H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Regulatory Rv3413c	active	shefin84	2012-10-05
	Co-expression (Functional linkage) KG. Thakur,AM. Joshi,B. Gopal Structural and biophysical studies on two promoter recognition domains of the extra-cytoplasmic function sigma factor sigma(C) from Mycobacterium tuberculosis. J. Biol. Chem. 2007
Interaction	Regulatory Rv3413c	active	shefin84	2012-10-05
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	Transcription Rv3212	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	Regulatory Rv2889c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Translation Rv2441c	active	priti.priety	2012-10-05
	Co expression Analysis H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Transcription Rv2396	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv2396	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Transcription Rv2396	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Regulatory Rv2348c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv2348c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	Regulatory Rv1883c	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) authors,RP. Carithers,DC. Yoch,DI. Arnon Two forms of nitrogenase from the photosynthetic bacterium Rhodospirillum rubrum. J. Bacteriol. 1979
Interaction	Regulatory Rv1883c	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) authors,LM. Iyer,EV. Koonin,L. Aravind Adaptations of the helix-grip fold for ligand binding and catalysis in the START domain superfamily. Proteins 2001
Interaction	Regulatory Rv1816	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	Regulatory Rv1815	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	Regulatory Rv1450c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) authors,JE. Clark-Curtiss,SE. Haydel Molecular genetics of Mycobacterium tuberculosis pathogenesis. Annu. Rev. Microbiol. 2003
Interaction	Regulatory Rv1450c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) J. Flores & C. Espitia Differential expression of PE and PE_PGRS genes in Mycobacterium tuberculosis strains. Gene 2003
Interaction	Regulatory Rv1450c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	Transcription Rv0685	active	sourish10	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0685	active	sourish10	2012-10-05
	Co-expression (Functional linkage) H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	Transcription Rv0684	active	sourish10	2012-10-05
	Co-expression (Functional linkage) H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Regulatory Rv0182c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	Regulatory Rv0124	active	prabhakarsmail	2012-10-05
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	RegulatedBy Rv0182c	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	Regulates Rv3875	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3874	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3538	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3537	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3418c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3417c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3414c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3414c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1884c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1815	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0341	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulatory Rv3675	active	jhum4u2006	2012-10-03
	Co-expression (Functional linkage) authors,V. Makarov,G. Manina,K. Mikusova,U. Möllmann,O. Ryabova,B. Saint-Joanis,N. Dhar,MR. Pasca,S. Buroni,AP. Lucarelli,A. Milano,E. De Rossi,M. Belanova,A. Bobovska,P. Dianiskova,J. Kordulakova,C. Sala,E. Fullam,P. Schneider,JD. McKinney,P. Brodin,T. Christophe,S. Waddell,P. Butcher,J. Albrethsen,I. Rosenkrands,R. Brosch,V. Nandi,S. Bharath,S. Gaonkar,RK. Shandil,V. Balasubramanian,T. Balganesh,S. Tyagi,J. Grosset,G. Riccardi,ST. Cole Benzothiazinones kill Mycobacterium tuberculosis by blocking arabinan synthesis. Science 2009
Interaction	Regulatory Rv3675	active	jhum4u2006	2012-10-03
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004