Rv3461c - 50S ribosomal protein L36 rpmJ

Protein Domains

Gene Information
Locus	Rv3461c
Symbol	rpmJ
Gene Name	50S ribosomal protein L36 rpmJ
Location	3880286 - 3880399 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:114 bp Protein:38 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	3860
Related Genes	Acel_0330 BL1603 MAP4229 MAV_4402 Mkms_1126 ML1961 Mmcs_1109 MSMEG_1520 MUL_0844 Mvan_1432 nfa8330 PPA1831 SAV4950
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3461c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3461c Transcript 1
MKVNPSVKPICDKCRLIRRHGRVMVICSDPRHKQRQG*

Genomic Sequence

>Rv3461c
GTGAAGGTAAACCCGAGCGTCAAGCCGATCTGTGACAAGTGCAGGCTGATCCGTCGGCAC
GGGCGGGTTATGGTGATCTGTTCCGATCCGCGTCACAAACAAAGGCAGGGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009