Rv3504 - acyl-CoA dehydrogenase fadE26

Expression: Most Significant Conditions for Rv3504

Protein Domains

Gene Information
Locus	Rv3504
Symbol	fadE26
Gene Name	acyl-CoA dehydrogenase fadE26
Location	3922471 - 3923673 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1203 bp Protein:401 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22617
Related Genes	MAP0559c MAV_0652 Mkms_4710 Mmcs_4622 MSMEG_5906 MT3608 MUL_4067 Mvan_5206 nfa5320
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3504
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3504 Transcript 1
MRISYTPQQEELRRELRSYFATLMTPERREALSSVQGEYGVGNVYRETIAQMGRDGWLAL
GWPKEYGGQGRSAMDQLIFTDEAAIAGAPVPFLTINSVAPTIMAYGTDEQKRFFLPRIAA
GDLHFSIGYSEPGAGTDLANLRTTAVRDGDDYVVNGQKMWTSLIQYADYVWLAVRTNPES
SGAKKHRGISVLIVPTTAEGFSWTPVHTMAGPDTSATYYSDVRVPVANRVGEENAGWKLV
TNQLNHERVALVSPAPIFGCLREVREWAQNTKDAGGTRLIDSEWVQLNLARVHAKAEVLK
LINWELASSQSGPKDAGPSPADASAAKVFGTELATEAYRLLMEVLGTAATLRQNSPGALL
RGRVERMHRACLILTFGGGTNEVQRDIIGMVALGLPRANR*

Genomic Sequence

>Rv3504
ATGCGCATCAGTTACACCCCGCAGCAGGAGGAGCTGCGCCGCGAGCTGCGCTCGTACTTT
GCCACGTTGATGACGCCGGAACGCCGGGAGGCGCTGAGCTCGGTCCAGGGTGAATACGGC
GTCGGCAATGTCTACCGGGAGACGATCGCGCAAATGGGCCGCGACGGGTGGCTTGCGCTG
GGCTGGCCCAAGGAATACGGCGGCCAGGGCCGCTCGGCGATGGACCAGCTGATCTTCACC
GATGAAGCCGCCATCGCCGGTGCACCGGTGCCGTTCCTGACCATCAACAGCGTGGCGCCG
ACGATCATGGCCTACGGAACCGACGAGCAGAAGAGGTTTTTCCTGCCCCGGATCGCCGCC
GGGGATCTGCACTTCTCGATCGGCTACTCCGAGCCCGGCGCCGGCACCGACCTGGCCAAC
CTGCGCACCACCGCGGTTCGCGACGGCGATGACTATGTGGTCAACGGCCAGAAGATGTGG
ACCAGCCTGATTCAGTACGCCGACTACGTCTGGTTAGCGGTACGCACCAACCCGGAGTCT
TCTGGGGCCAAAAAACACCGTGGCATATCGGTGTTAATCGTGCCGACGACCGCTGAGGGC
TTCTCCTGGACTCCAGTGCACACCATGGCCGGTCCGGACACCAGCGCCACCTACTACTCC
GACGTGCGGGTACCGGTGGCCAACCGGGTCGGTGAGGAAAACGCCGGCTGGAAGCTGGTG
ACCAACCAGCTCAACCACGAGCGGGTCGCCCTGGTGTCGCCGGCACCGATTTTCGGATGC
CTGCGCGAGGTCCGCGAATGGGCACAAAACACCAAGGACGCCGGCGGCACCAGGCTGATC
GACTCGGAGTGGGTGCAGCTCAACCTGGCCCGGGTACACGCCAAGGCCGAAGTCCTCAAG
CTGATCAACTGGGAGCTGGCTTCCTCGCAAAGTGGGCCGAAGGACGCTGGACCGTCACCG
GCCGATGCGTCGGCGGCCAAGGTGTTCGGTACCGAGCTGGCCACCGAGGCCTACCGGCTG
CTGATGGAGGTGTTGGGCACTGCGGCGACCCTGCGCCAGAATTCGCCAGGCGCGTTGCTG
CGCGGCCGCGTCGAACGGATGCACCGGGCGTGCCTGATCCTGACGTTCGGCGGCGGCACC
AACGAAGTCCAGCGCGACATCATCGGCATGGTCGCGCTGGGACTGCCGCGAGCCAACCGC
TGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	Regulatory Rv3574	active	jgalag	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	Regulatory Rv3416	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2034	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv1359	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv0445c	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3133c	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2034	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1359	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Other	product:not yet determined	active	rslayden	2012-03-05
	in preparation Thomas, Sampson
Term	EC:1.3.99.- Oxidoreductases. Acting on the CH-CH group of donors. With other acceptors. - NR	active	rslayden	2012-03-05
	in preparation Thomas, Sampson
Symbol	FadE26	active	rslayden	2012-03-05
	in preparation Thomas, Sampson