Rv3568c - biphenyl-2,3-diol 1,2-dioxygenase bphC

Expression: Most Significant Conditions for Rv3568c

Protein Domains

Gene Information
Locus	Rv3568c
Symbol	bphC
Gene Name	biphenyl-2,3-diol 1,2-dioxygenase bphC
Location	4009297 - 4010199 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:903 bp Protein:301 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	19727
Related Genes	MAP0499 MAV_0593 Mkms_4793 Mmcs_4707 MSMEG_6036 MT3673 MUL_4139 Mvan_5306 nfa4720
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3568c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3568c Transcript 1
MSIRSLGYLRIEATDMAAWREYGLKVLGMVEGKGAPEGALYLRMDDFPARLVVVPGEHDR
LLEAGWECANAEGLQEIRNRLDLEGTPYKEATAAELADRRVDEMIRFADPSGNCLEVFHG
TALEHRRVVSPYGHRFVTGEQGMGHVVLSTRDDAEALHFYRDVLGFRLRDSMRLPPQMVG
RPADGPPAWLRFFGCNPRHHSLAFLPMPTSSGIVHLMVEVEQADDVGLCLDRALRRKVPM
SATLGRHVNDLMLSFYMKTPGGFDIEFGCEGRQVDDRDWIARESTAVSLWGHDFTVGARG
*

Genomic Sequence

>Rv3568c
ATGAGCATCCGGTCGCTGGGCTATCTGCGCATCGAGGCCACTGACATGGCTGCCTGGCGG
GAGTATGGACTGAAGGTCCTGGGCATGGTCGAGGGCAAAGGGGCCCCAGAAGGGGCCCTG
TATCTGCGGATGGATGACTTTCCGGCCCGGCTGGTGGTCGTGCCCGGTGAGCACGACAGG
CTGTTGGAGGCCGGTTGGGAATGCGCGAATGCCGAAGGCCTGCAGGAAATCCGGAACCGC
CTGGATTTGGAGGGCACGCCGTACAAAGAGGCCACCGCCGCCGAGCTGGCCGATCGCCGG
GTGGACGAGATGATCCGGTTTGCCGACCCTTCCGGCAATTGCCTGGAGGTCTTCCACGGT
ACCGCGCTGGAACACCGCCGAGTGGTCAGCCCGTATGGGCACAGGTTCGTCACCGGTGAG
CAGGGTATGGGCCATGTGGTGCTGTCCACCCGCGACGATGCTGAGGCGTTGCATTTCTAC
CGAGACGTGCTCGGCTTTCGGCTGCGTGACTCGATGCGGCTACCGCCACAGATGGTAGGG
CGGCCCGCCGACGGGCCGCCAGCCTGGCTGCGTTTCTTCGGCTGTAACCCGCGTCACCAC
TCGTTGGCCTTCCTGCCGATGCCGACGTCCAGCGGCATCGTGCACCTGATGGTCGAGGTC
GAGCAGGCCGACGACGTGGGCCTGTGCCTGGACCGGGCGTTGCGGCGCAAGGTGCCGATG
TCGGCCACCCTGGGCCGGCATGTCAACGACCTGATGCTGTCGTTCTACATGAAGACGCCC
GGTGGCTTCGACATCGAATTCGGTTGTGAGGGCAGGCAAGTCGACGATCGGGACTGGATC
GCCCGGGAGAGTACTGCGGTCAGCCTATGGGGTCACGATTTCACCGTAGGCGCTCGCGGC
TAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	M.smegmatis orthology based inference. Orthologous pair regulator-target found in M.smegmatis. SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Term	EC:1.13.11.2 Catechol 2,3-dioxygenase. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from its native host authors,KC. Yam,I. D'Angelo,R. Kalscheuer,H. Zhu,JX. Wang,V. Snieckus,LH. Ly,PJ. Converse,WR. Jacobs,N. Strynadka,LD. Eltis Studies of a ring-cleaving dioxygenase illuminate the role of cholesterol metabolism in the pathogenesis of Mycobacterium tuberculosis. PLoS Pathog. 2009
Term	EC:1.13.11.39 Biphenyl-2,3-diol 1,2-dioxygenase. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from its native host authors,KC. Yam,I. D'Angelo,R. Kalscheuer,H. Zhu,JX. Wang,V. Snieckus,LH. Ly,PJ. Converse,WR. Jacobs,N. Strynadka,LD. Eltis Studies of a ring-cleaving dioxygenase illuminate the role of cholesterol metabolism in the pathogenesis of Mycobacterium tuberculosis. PLoS Pathog. 2009
Term	EC:1.13.11.25 dioxygenase. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from its native host authors,KC. Yam,I. D'Angelo,R. Kalscheuer,H. Zhu,JX. Wang,V. Snieckus,LH. Ly,PJ. Converse,WR. Jacobs,N. Strynadka,LD. Eltis Studies of a ring-cleaving dioxygenase illuminate the role of cholesterol metabolism in the pathogenesis of Mycobacterium tuberculosis. PLoS Pathog. 2009
Term	EC:1.13.11.25 dioxygenase. - NR	active	nsampson	2012-03-05
	Assay of protein purified to homogeneity from a heterlogous host authors,KC. Yam,I. D'Angelo,R. Kalscheuer,H. Zhu,JX. Wang,V. Snieckus,LH. Ly,PJ. Converse,WR. Jacobs,N. Strynadka,LD. Eltis Studies of a ring-cleaving dioxygenase illuminate the role of cholesterol metabolism in the pathogenesis of Mycobacterium tuberculosis. PLoS Pathog. 2009
Term	EC:1.13.11.25 dioxygenase. - NR	active	nsampson	2012-03-05
	Assay of unpurified protein expressed in a heterlogous host authors,R. Van der Geize,K. Yam,T. Heuser,MH. Wilbrink,H. Hara,MC. Anderton,E. Sim,L. Dijkhuizen,JE. Davies,WW. Mohn,LD. Eltis A gene cluster encoding cholesterol catabolism in a soil actinomycete provides insight into Mycobacterium tuberculosis survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2007
Name	3,4-DHSA dioxygenase	active	cstolte	2011-01-03
	Yam (2009) - demonstrated that deletion of HsaC makes cholesterol toxic for mycobacteria even with another carbon source, possibly due to buildup of catechols.
Symbol	HsaC	active	cstolte	2011-01-03
	Yam (2009) - demonstrated that deletion of HsaC makes cholesterol toxic for mycobacteria even with another carbon source, possibly due to buildup of catechols.
Name	3,4-DHSA dioxygenase	active	jgalag	2010-09-02
	Yam (2009) - demonstrated that deletion of HsaC makes cholesterol toxic for mycobacteria even with another carbon source, possibly due to buildup of catechols.
Symbol	HsaC	active	jgalag	2010-09-02
	Yam (2009) - demonstrated that deletion of HsaC makes cholesterol toxic for mycobacteria even with another carbon source, possibly due to buildup of catechols.