Rv3597c - iron-regulated lsr2 protein precursor

Expression: Most Significant Conditions for Rv3597c

Protein Domains

Gene Information
Locus	Rv3597c
Symbol	lsr2
Gene Name	iron-regulated lsr2 protein precursor
Location	4040981 - 4041319 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:339 bp Protein:113 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28751
Related Genes	Acel_0218 MAP0460 MAV_0555 Mkms_4843 ML0234 Mmcs_4757 MSMEG_6092 MT3704 MUL_4180 Mvan_5359 nfa4120 PPA0277 SAV4695
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3597c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3597c Transcript 1
MAKKVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRVGG
RRRGRSGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRIPADVIDAYHAAT*

Genomic Sequence

>Rv3597c
ATGGCGAAGAAAGTAACCGTCACCTTGGTCGACGATTTCGACGGTTCGGGCGCCGCCGAC
GAAACGGTCGAATTCGGGCTTGACGGGGTGACCTATGAGATCGACCTTTCCACTAAGAAT
GCCACGAAACTGCGTGGCGACCTGAAGCAATGGGTGGCGGCGGGCCGTCGCGTCGGTGGG
CGCCGGCGCGGCCGTTCCGGATCCGGCCGTGGACGTGGCGCGATCGACCGCGAGCAGAGC
GCGGCGATCCGCGAATGGGCTCGTCGTAACGGGCACAATGTGTCGACGCGAGGCCGGATC
CCGGCCGACGTCATCGACGCATACCACGCGGCGACCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3924c	active	extern:JZUCKER	2012-10-05
	authors,L. Salazar Inhibition of chromosome replication in Mycobacterium smegmatis: effect of the rpmH-dnaA promoter region. Microbiology (Reading, Engl.) 2000
Interaction	Regulatory Rv3924c	active	extern:JZUCKER	2012-10-05
	BR. Gordon,Y. Li,L. Wang,A. Sintsova,H. van Bakel,S. Tian,WW. Navarre,B. Xia,J. Liu Lsr2 is a nucleoid-associated protein that targets AT-rich sequences and virulence genes in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2010
Interaction	Transcription Rv2846c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) R. Colangeli, D. Helb et al. Transcriptional regulation of multi-drug tolerance and antibiotic-induced responses by the histone-like protein Lsr2 in M. tuberculosis. PLoS Pathog. 2007
Interaction	Transcription Rv0341	active	sourish10	2012-10-05
	Co-expression (Functional linkage) R. Colangeli, D. Helb et al. Transcriptional regulation of multi-drug tolerance and antibiotic-induced responses by the histone-like protein Lsr2 in M. tuberculosis. PLoS Pathog. 2007
Interaction	Transcription Rv0343	active	sourish10	2012-10-05
	Co-expression (Functional linkage) R. Colangeli, D. Helb et al. Transcriptional regulation of multi-drug tolerance and antibiotic-induced responses by the histone-like protein Lsr2 in M. tuberculosis. PLoS Pathog. 2007
Interaction	Transcription Rv0342	active	sourish10	2012-10-05
	Co-expression (Functional linkage) R. Colangeli, D. Helb et al. Transcriptional regulation of multi-drug tolerance and antibiotic-induced responses by the histone-like protein Lsr2 in M. tuberculosis. PLoS Pathog. 2007
Interaction	PhysicalInteraction Rv2412	active	kholia.trupti	2012-10-05
	ChIP (Physical interaction) BR. Gordon,Y. Li,L. Wang,A. Sintsova,H. van Bakel,S. Tian,WW. Navarre,B. Xia,J. Liu Lsr2 is a nucleoid-associated protein that targets AT-rich sequences and virulence genes in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2010