Rv3620c - Esat-6 like protein esxW

Expression: Most Significant Conditions for Rv3620c

Protein Domains

Gene Information
Locus	Rv3620c
Symbol	esxW
Gene Name	Esat-6 like protein esxW
Location	4060295 - 4060591 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:297 bp Protein:99 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11439
Related Genes	MT3722
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3620c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3620c Transcript 1
MTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQM
NQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS*

Genomic Sequence

>Rv3620c
ATGACCTCGCGTTTTATGACGGATCCGCACGCGATGCGGGACATGGCGGGCCGTTTTGAG
GTGCACGCCCAGACGGTGGAGGACGAGGCTCGCCGGATGTGGGCGTCCGCGCAAAACATT
TCCGGCGCGGGCTGGAGTGGCATGGCCGAGGCGACCTCGCTAGACACCATGACCCAGATG
AATCAGGCGTTTCGCAACATCGTGAACATGCTGCACGGGGTGCGTGACGGGCTGGTTCGC
GACGCCAACAACTACGAACAGCAAGAGCAGGCCTCCCAGCAGATCCTCAGCAGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3874	active	ahal4789	2012-10-05
	Yeast two-hybrid (Physical interaction) G. Garufi, E. Butler et al. ESAT-6-like protein secretion in Bacillus anthracis. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv3874	active	sourish10	2012-10-05
	Yeast two-hybrid (Physical interaction) G. Garufi, E. Butler et al. ESAT-6-like protein secretion in Bacillus anthracis. J. Bacteriol. 2008
Interaction	Activation Rv3619c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,B. Sidders,M. Withers,SL. Kendall,J. Bacon,SJ. Waddell,J. Hinds,P. Golby,F. Movahedzadeh,RA. Cox,R. Frita,AM. Ten Bokum,L. Wernisch,NG. Stoker Quantification of global transcription patterns in prokaryotes using spotted microarrays. Genome Biol. 2007
Interaction	Activation Rv3619c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,K. Moroi,T. Sato Comparison between procaine and isocarboxazid metabolism in vitro by a liver microsomal amidase-esterase. Biochem. Pharmacol. 1975
Interaction	Activation Rv3619c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,UN. Wiesmann,S. DiDonato,NN. Herschkowitz Effect of chloroquine on cultured fibroblasts: release of lysosomal hydrolases and inhibition of their uptake. Biochem. Biophys. Res. Commun. 1975
Interaction	Activation Rv3619c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	Activation Rv3619c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	Activation Rv3619c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) M. Marmiesse, P. Brodin et al. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2004
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001