Rv3692 - methanol dehydrogenase transcriptional regulator moxR2

Expression: Most Significant Conditions for Rv3692

Protein Domains

Gene Information
Locus	Rv3692
Symbol	moxR2
Gene Name	methanol dehydrogenase transcriptional regulator moxR2
Location	4133516 - 4134592 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1077 bp Protein:359 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	34622
Related Genes	Acel_0659 CE1891 cg2188 MAP0359c MAV_0412 Mkms_4949 Mmcs_4860 MSMEG_6219 MT3794 MUL_4275 Mvan_5455 nfa920 SAV5058
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3692
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3692 Transcript 1
MTQSASNPQAPPTQTPGAELPGYPPQAGGAPTAAPSGPHPHRAEAESARDALLALRAEVA
KAVVGQDGVISGLVIALLCRGHVLLEGVPGVAKTLIVRAMSAALQLEFKRVQFTPDLMPG
DVTGSLVYDARTAEFVFRPGPVFTNLLLADEINRTPPKTQAALLEAMEERQVSVEGEPKP
LPNPFIVAATQNPIEYEGTYQLPEAQLDRFLLKLNVTLPARDSEIAILDRHAHGFDPRDL
SAINPVAGPAELAAGREAVRHVLVANEVLGYIVDIVGATRSSPALQLGVSPRGATALLGT
ARSWAWLSGRDYVTPDDVKAMARPTLRHRVMLRPEAELEGATPDGVLDGILASVPVPR*

Genomic Sequence

>Rv3692
GTGACACAGTCCGCGTCCAACCCGCAAGCTCCTCCCACCCAAACCCCTGGCGCTGAATTG
CCCGGCTATCCCCCGCAAGCGGGTGGTGCCCCTACAGCGGCCCCTTCCGGGCCGCATCCT
CACCGGGCTGAAGCAGAATCGGCACGTGATGCATTGCTGGCATTACGCGCCGAGGTCGCC
AAGGCCGTCGTCGGACAGGACGGGGTGATCAGCGGCCTGGTGATCGCTCTGTTGTGCCGT
GGGCACGTGCTCCTGGAAGGTGTTCCAGGAGTGGCGAAGACGCTGATTGTCCGCGCTATG
TCCGCCGCTTTGCAACTGGAGTTCAAGCGGGTGCAGTTCACCCCTGACCTGATGCCAGGC
GACGTCACCGGTTCACTGGTCTACGATGCCCGCACCGCCGAGTTCGTGTTCCGGCCGGGC
CCGGTGTTCACCAATTTGCTGCTGGCCGATGAGATCAACCGCACCCCACCCAAGACGCAG
GCCGCGCTGCTCGAGGCGATGGAAGAGCGTCAAGTCAGTGTGGAGGGTGAGCCTAAGCCG
CTGCCCAACCCGTTCATCGTCGCCGCGACGCAGAACCCGATCGAATACGAGGGCACCTAT
CAGTTGCCCGAAGCCCAACTGGATCGTTTCCTGCTGAAACTGAATGTGACACTGCCGGCA
CGCGATTCCGAGATCGCCATCCTTGACCGGCACGCGCACGGGTTCGACCCGCGCGATCTA
TCCGCGATCAATCCGGTGGCCGGGCCGGCCGAGCTGGCGGCTGGCCGCGAGGCGGTGCGC
CACGTGCTGGTCGCTAATGAGGTGCTGGGCTACATCGTCGACATCGTCGGGGCCACCCGC
TCCTCGCCCGCACTACAGCTCGGTGTGTCGCCGCGTGGGGCAACCGCCCTGCTGGGCACC
GCCCGGTCCTGGGCGTGGCTGTCCGGGCGCGATTACGTCACCCCCGACGACGTGAAGGCG
ATGGCCCGACCGACGCTACGCCACCGGGTGATGCTACGCCCGGAAGCCGAGCTGGAAGGC
GCCACACCCGACGGCGTTCTCGACGGAATTCTGGCCTCGGTTCCGGTGCCCCGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3223c	active	aparna.vchalam	2012-10-05
	S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Transcription Rv3223c	active	priyadarshinipriyanka2001	2012-10-05
	S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Regulatory Rv2939	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2939	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2935	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2935	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2934	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2934	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2933	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2933	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2932	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2932	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2931	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2931	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2930	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2930	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3134c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3133c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3132c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2939	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2938	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2937	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2936	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2935	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2934	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2933	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2932	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2931	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2930	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv1094	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009