Rv3890c - Esat-6 like protein esxC

Expression: Most Significant Conditions for Rv3890c

Protein Domains

Gene Information
Locus	Rv3890c
Symbol	esxC
Gene Name	Esat-6 like protein esxC
Location	4373726 - 4374013 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:288 bp Protein:96 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9283
Related Genes	MAP0161 MAV_0154 MT4005
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3890c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3890c Transcript 1
MSDQITYNPGAVSDFASDVGSRAGQLHMIYEDTASKTNALQEFFAGHGAQGFFDAQAQML
SGLQGLIETVGQHGTTTGHVLDNAIGTDQAIAGLF*

Genomic Sequence

>Rv3890c
ATGTCAGATCAAATCACGTATAACCCGGGAGCCGTATCCGACTTCGCTTCCGACGTGGGC
TCGCGCGCCGGCCAGCTCCACATGATTTACGAAGACACCGCCAGCAAAACAAATGCGCTG
CAAGAGTTTTTCGCGGGCCACGGCGCGCAAGGGTTTTTCGACGCCCAGGCGCAGATGCTG
TCGGGGCTGCAGGGGCTCATTGAGACGGTGGGTCAGCATGGGACTACCACCGGCCACGTG
CTGGACAACGCGATCGGAACCGACCAGGCCATCGCGGGCTTGTTCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Structural Analysis B. Callahan, K. Nguyen et al. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Structural Analysis KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Structural Analysis NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Spectrophotometric B. Callahan, K. Nguyen et al. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Spectrophotometric KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Spectrophotometric NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Structural Analysis B. Callahan, K. Nguyen et al. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Structural Analysis KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Structural Analysis authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Structural Analysis NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Spectrophotometric B. Callahan, K. Nguyen et al. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Spectrophotometric KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Spectrophotometric authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3891c	active	shahanup86	2012-10-05
	Spectrophotometric NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003