Rv3906c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv3906c

Protein Domains

Gene Information
Locus	Rv3906c
Symbol
Gene Name	conserved hypothetical protein
Location	4391097 - 4391606 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:510 bp Protein:170 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	2204
Related Genes	jk0490 MAP4331c MAV_5293 Mkms_5485 Mmcs_5396 MSMEG_6925 MT4025 Mvan_6060 nfa56500
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3906c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3906c Transcript 1
MEYCIAGDDGSAGIWNRPFDVDLDGDGRLDAIGLDLDGDGLRDDALADFDGDDVADHAVF
DVDNDGTPESYFIDDGSGTWAVAVDRGGQLRWYGLDGVEHTGGPLVDFDGFGGLDDRLLD
TDGDGLADRVLCAGEQRVTGYVDTDGDGRWDVRLTDTDGDGTADGASSL*

Genomic Sequence

>Rv3906c
GTGGAGTACTGCATAGCCGGCGACGACGGCAGCGCCGGGATCTGGAACCGCCCGTTCGAC
GTCGACCTCGACGGTGACGGCCGGCTGGACGCGATTGGCCTGGATCTCGACGGCGACGGT
CTGCGCGATGACGCGCTGGCCGACTTCGACGGCGACGACGTTGCCGACCACGCCGTATTC
GACGTCGACAACGACGGCACCCCGGAAAGCTACTTCATCGACGACGGATCGGGGACCTGG
GCGGTCGCCGTCGACCGCGGCGGACAACTGCGCTGGTATGGGCTCGACGGCGTCGAGCAC
ACCGGTGGTCCACTGGTTGACTTCGACGGGTTCGGTGGTTTAGACGACCGGCTACTCGAT
ACCGACGGTGACGGGCTGGCCGATCGGGTGCTGTGTGCTGGTGAGCAGCGTGTGACCGGA
TACGTCGACACCGATGGCGACGGCCGCTGGGACGTACGGCTGACCGACACCGACGGCGAC
GGCACCGCCGACGGCGCCAGCAGCCTTTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3911	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Transcription Rv3911	active	sourish10	2012-10-05
	Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Transcription Rv3911	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	Transcription Rv3911	active	sourish10	2012-10-05
	Co-expression (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3905c	active	sourish10	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3904c	active	sourish10	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3905c	active	sourish10	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3904c	active	sourish10	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3905c	active	sourish10	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3904c	active	sourish10	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3905c	active	sourish10	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3904c	active	sourish10	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3905c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3905c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3905c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3905c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3905c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3905c	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3905c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3905c	active	shahanup86	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3904c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3904c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3904c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3904c	active	kaveri.verma	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3904c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3904c	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3904c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,R. Louise,V. Skjøt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3904c	active	shahanup86	2012-10-05
	Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007