Rv2940c - multifunctional mycocerosic acid synthase membrane-associated mas

Expression: Most Significant Conditions for Rv2940c

Protein Domains

Gene Information
Locus	Rv2940c
Symbol	mas
Gene Name	multifunctional mycocerosic acid synthase membrane-associated mas
Location	3276380 - 3282715 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:6336 bp Protein:2112 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	30809
Related Genes	MAP3764c Mkms_2876 Mkms_2877 ML0139 ML2353 ML2354 Mmcs_2832 Mmcs_2833 MT3005 MT3010 MUL_2010 MUL_2015 Mvan_3123 Mvan_3124 Rv2935
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2940c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2940c Transcript 1
MESRVTPVAVIGMGCRLPGGINSPDKLWESLLRGDDLVTEIPPDRWDADDYYDPEPGVPG
RSVSRWGGFLDDVAGFDAEFFGISEREATSIDPQQRLLLETSWEAIEHAGLDPASLAGSS
TAVFTGLTHEDYLVLTTTAGGLASPYVVTGLNNSVASGRIAHTLGLHGPAMTFDTACSSG
LMAVHLACRSLHDGEADLALAGGCAVLLEPHASVAASAQGMLSSTGRCHSFDADADGFVR
SEGCAMVLLKRLPDALRDGNRIFAVVRGTATNQDGRTETLTMPSEDAQVAVYRAALAAAG
VQPETVGVVEAHGTGTPIGDPIEYRSLARVYGAGTPCALGSAKSNMGHSTASAGTVGLIK
AILSLRHGVVPPLLHFNRLPDELSDVETGLFVPQAVTPWPNGNDHTPKRVAVSSFGMSGT
NVHAIVEEAPAEASAPESSPGDAEVGPRLFMLSSTSSDALRQTARQLATWVEEHQDCVAA
SDLAYTLARGRAHRPVRTAVVAANLPELVEGLREVADGDALYDAAVGHGDRGPVWVFSGQ
GSQWAAMGTQLLASEPVFAATIAKLEPVIAAESGFSVTEAITAQQTVTGIDKVQPAVFAV
QVALAATMEQTYGVRPGAVVGHSMGESAAAVVAGALSLEDAARVICRRSKLMTRIAGAGA
MGSVELPAKQVNSELMARGIDDVVVSVVASPQSTVIGGTSDTVRDLIARWEQRDVMAREV
AVDVASHSPQVDPILDDLAAALADIAPMTPKVPYYSATLFDPREQPVCDGAYWVDNLRNT
VQFAAAVQAAMEDGYRVFAELSPHPLLTHAVEQTGRSLDMSVAALAGMRREQPLPHGLRG
LLTELHRAGAALDYSALYPAGRLVDAPLPAWTHARLFIDDDGQEQRAQGACTITVHPLLG
SHVRLTEEPERHVWQGDVGTSVLSWLSDHQVHNVAALPGAAYCEMALAAAAEVFGEAAEV
RDITFEQMLLLDEQTPIDAVASIDAPGVVNFTVETNRDGETTRHATAALRAAEDDCPPPG
YDITALLQAHPHAVNGTAMRESFAERGVTLGAAFGGLTTAHTAEAGAATVLAEVALPASI
RFQQGAYRIHPALLDACFQSVGAGVQAGTATGGLLLPLGVRSLRAYGPTRNARYCYTRLT
KAFNDGTRGGEADLDVLDEHGTVLLAVRGLRMGTGTSERDERDRLVSERLLTLGWQQRAL
PEVGDGEAGSWLLIDTSNAVDTPDMLASTLTDALKSHGPQGTECASLSWSVQDTPPNDQA
GLEKLGSQLRGRDGVVIVYGPRVGDPDEHSLLAGREQVRHLVRITRELAEFEGELPRLFV
VTRQAQIVKPHDSGERANLEQAGLRGLLRVISSEHPMLRTTLIDVDEHTDVERVAQQLLS
GSEEDETAWRNGDWYVARLTPSPLGHEERRTAVLDPDHDGMRVQVRRPGDLQTLEFVASD
RVPPGPGQIEVAVSMSSINFADVLIAFGRFPIIDDREPQLGMDFVGVVTAVGEGVTGHQV
GDRVGGFSEGGCWRTFLTCDANLAVTLPPGLTDEQAITAATAHATAWYGLNDLAQIKAGD
KVLIHSATGGVGQAAISIARAKGAEIFATAGNPAKRAMLRDMGVEHVYDSRSVEFAEQIR
RDTDGYGVDIVLNSLTGAAQRAGLELLAFGGRFVEIGKADVYGNTRLGLFPFRRGLTFYY
LDLALMSVTQPDRVRELLATVFKLTADGVLTAPQCTHYPLAEAADAIRAMSNAEHTGKLV
LDVPRSGRRSVAVTPEQAPLYRRDGSYIITGGLGGLGLFFASKLAAAGCGRIVLTARSQP
NPKARQTIEGLRAAGADIVVECGNIAEPDTADRLVSAATATGLPLRGVLHSAAVVEDATL
TNITDELIDRDWSPKVFGSWNLHRATLGQPLDWFCLFSSGAALLGSPGQGAYAAANSWVD
VFAHWRRAQGLPVSAIAWGAWGEVGRATFLAEGGEIMITPEEGAYAFETLVRHDRAYSGY
IPILGAPWLADLVRRSPWGEMFASTGQRSRGPSKFRMELLSLPQDEWAGRLRRLLVEQAS
VILRRTIDADRSFIEYGLDSLGMLEMRTHVETETGIRLTPKVIATNNTARALAQYLADTL
AEEQAAAPAAS*

Genomic Sequence

>Rv2940c
ATGGAATCACGTGTCACTCCCGTTGCGGTGATCGGGATGGGATGTCGGCTTCCTGGGGGG
ATCAACTCGCCCGACAAACTGTGGGAGTCGTTGCTGCGCGGTGATGACTTGGTCACCGAG
ATTCCGCCCGACCGCTGGGACGCCGACGACTATTACGACCCTGAGCCAGGGGTTCCCGGG
CGGTCGGTGTCCCGGTGGGGTGGGTTCCTTGACGACGTCGCCGGTTTCGATGCTGAGTTC
TTCGGGATTAGCGAGCGGGAAGCGACCTCGATCGATCCGCAGCAGCGGCTACTGCTGGAA
ACGTCGTGGGAGGCGATCGAGCATGCTGGTCTGGATCCGGCGTCGTTGGCCGGGTCCTCG
ACGGCCGTTTTTACTGGGCTGACCCACGAGGACTACCTGGTACTCACCACAACGGCGGGC
GGTTTGGCCAGTCCATATGTGGTTACCGGCCTCAACAACAGTGTGGCGTCAGGGCGGATC
GCGCACACATTGGGTCTACATGGTCCGGCGATGACGTTTGACACCGCGTGTTCTTCGGGT
CTGATGGCGGTGCACCTGGCCTGCCGCAGCCTGCATGACGGCGAAGCTGACCTCGCTTTG
GCGGGCGGTTGTGCGGTGCTGCTGGAGCCGCATGCCAGTGTGGCGGCGTCTGCGCAGGGC
ATGCTGTCGTCAACCGGTCGGTGCCATTCATTCGATGCTGACGCGGATGGGTTTGTGCGT
TCCGAGGGCTGCGCGATGGTGTTGCTGAAGCGACTGCCGGATGCGCTGCGCGACGGTAAT
CGGATCTTCGCCGTGGTGCGTGGCACGGCCACCAATCAGGACGGCCGCACGGAGACGCTC
ACCATGCCGTCCGAGGACGCCCAGGTTGCCGTGTACCGTGCGGCGTTGGCGGCGGCGGGC
GTGCAGCCCGAAACGGTCGGTGTGGTCGAGGCGCACGGCACCGGTACGCCAATCGGCGAC
CCGATTGAGTACCGCAGCCTGGCGCGGGTGTATGGCGCGGGCACCCCCTGCGCGCTTGGA
TCGGCCAAGAGCAACATGGGGCACAGCACGGCATCGGCGGGGACCGTCGGGCTGATCAAG
GCAATTCTGTCACTGCGGCACGGGGTGGTGCCGCCGCTGCTGCATTTCAATCGGCTGCCC
GATGAGCTTTCCGACGTCGAGACCGGGCTCTTTGTGCCGCAAGCGGTTACGCCGTGGCCC
AACGGTAATGATCACACACCGAAGCGGGTCGCGGTGTCCTCGTTCGGGATGTCCGGGACC
AACGTGCATGCCATCGTGGAAGAGGCCCCAGCAGAAGCTTCCGCACCCGAGAGTTCACCG
GGCGACGCTGAGGTGGGCCCGCGGCTATTCATGCTGTCGTCCACGTCCAGCGACGCACTG
CGCCAGACGGCCCGCCAACTAGCCACCTGGGTGGAAGAACACCAGGACTGCGTGGCGGCC
TCGGATCTGGCCTACACGCTGGCGCGTGGCCGCGCGCACCGGCCGGTGCGCACCGCGGTG
GTTGCCGCCAACCTGCCGGAGCTCGTCGAGGGTTTGCGCGAGGTGGCCGACGGTGACGCC
CTCTATGACGCGGCGGTGGGACACGGTGATCGAGGACCGGTCTGGGTCTTCTCCGGGCAA
GGGTCGCAGTGGGCGGCGATGGGCACGCAATTGCTCGCCAGCGAACCAGTGTTCGCGGCC
ACCATCGCCAAGCTGGAGCCGGTGATCGCCGCAGAATCGGGATTCTCGGTGACCGAGGCG
ATAACGGCGCAGCAGACCGTGACCGGAATCGACAAAGTGCAGCCGGCAGTGTTCGCCGTT
CAGGTCGCGTTGGCCGCCACCATGGAGCAAACCTACGGAGTGCGGCCGGGCGCGGTCGTC
GGACACTCGATGGGTGAGTCGGCCGCGGCCGTCGTCGCGGGGGCACTGTCGCTCGAGGAC
GCGGCGCGCGTCATTTGCCGCCGCTCGAAGCTGATGACCCGCATAGCCGGTGCTGGTGCC
ATGGGCTCGGTGGAATTGCCCGCCAAGCAAGTGAATTCGGAGCTGATGGCACGCGGAATC
GACGATGTTGTGGTCTCGGTGGTGGCGTCCCCGCAATCCACGGTGATCGGCGGTACGAGC
GACACCGTTCGTGACCTCATCGCCCGTTGGGAGCAGCGGGACGTGATGGCGCGCGAGGTG
GCCGTCGACGTGGCGTCGCACTCGCCTCAAGTCGATCCGATACTCGACGATTTGGCCGCG
GCGCTGGCGGACATTGCTCCGATGACGCCCAAGGTGCCGTACTACTCGGCGACCCTGTTC
GACCCGCGCGAGCAGCCGGTGTGCGATGGCGCTTACTGGGTGGACAATCTGCGCAACACG
GTGCAGTTCGCCGCGGCGGTGCAGGCTGCGATGGAGGACGGCTACCGGGTCTTCGCGGAG
CTGTCGCCCCACCCGCTGCTTACCCACGCCGTCGAACAGACGGGCCGAAGCCTCGACATG
TCGGTCGCCGCCCTGGCCGGCATGCGGCGAGAGCAGCCTCTGCCGCATGGTCTGCGCGGC
TTGCTGACGGAGCTGCACCGCGCGGGCGCCGCTTTGGACTATTCGGCGCTGTATCCCGCT
GGGCGGCTGGTGGATGCGCCGCTGCCGGCGTGGACCCACGCCCGCCTATTCATCGACGAT
GATGGGCAAGAACAGCGGGCACAAGGTGCCTGCACCATCACCGTGCATCCGTTGCTTGGC
TCGCATGTGCGGCTGACTGAGGAACCTGAGCGCCACGTCTGGCAGGGCGACGTTGGCACC
TCGGTGCTGTCCTGGCTCAGCGATCATCAGGTGCATAACGTTGCCGCCCTTCCCGGCGCC
GCCTACTGCGAGATGGCTTTGGCTGCGGCCGCTGAGGTCTTCGGCGAAGCGGCTGAGGTT
CGCGACATCACCTTTGAGCAGATGTTGTTGCTCGACGAGCAGACCCCGATCGACGCCGTC
GCATCGATCGACGCGCCTGGTGTCGTCAACTTCACCGTGGAGACCAACCGGGACGGTGAA
ACCACCCGGCATGCCACCGCGGCGCTGCGCGCCGCCGAAGATGACTGCCCGCCGCCGGGG
TACGACATCACCGCTCTGCTGCAGGCGCATCCGCACGCCGTGAACGGGACCGCCATGCGG
GAATCGTTCGCCGAGCGTGGTGTTACTTTGGGCGCCGCGTTCGGTGGTCTGACCACCGCG
CATACCGCCGAGGCGGGAGCCGCGACGGTGCTGGCCGAGGTCGCGCTGCCCGCGTCGATC
CGGTTCCAGCAGGGCGCCTACCGAATCCACCCGGCGCTGCTGGACGCTTGTTTCCAGTCG
GTCGGCGCGGGCGTCCAGGCCGGTACGGCCACTGGTGGCCTGCTGTTGCCGTTGGGTGTG
CGCAGCCTGCGTGCCTACGGGCCTACCCGCAATGCCCGCTACTGCTACACGCGGTTGACC
AAGGCCTTCAACGACGGGACCCGAGGTGGTGAGGCCGACCTCGACGTGCTGGACGAGCAC
GGGACCGTCCTGTTGGCCGTGCGTGGGCTACGCATGGGAACCGGGACCTCCGAACGCGAC
GAGCGTGACCGCCTAGTCAGCGAGCGGCTACTGACCCTCGGATGGCAGCAGCGAGCGCTG
CCCGAGGTTGGCGACGGCGAGGCTGGATCGTGGCTATTGATCGACACTTCCAACGCCGTC
GACACCCCCGACATGTTGGCTTCCACGTTGACGGACGCGCTGAAGTCCCACGGCCCCCAA
GGCACCGAATGCGCCAGCCTGTCCTGGTCGGTCCAGGACACCCCGCCCAACGATCAAGCT
GGCCTCGAAAAGCTGGGCAGCCAGCTGCGTGGCCGCGATGGTGTGGTGATCGTGTATGGG
CCTCGCGTCGGCGACCCCGATGAGCACAGTCTGCTGGCCGGTCGTGAACAGGTCCGTCAC
CTGGTTCGGATCACCCGGGAACTGGCTGAATTCGAGGGCGAGCTGCCGCGCTTGTTCGTG
GTGACCAGACAAGCCCAGATAGTGAAGCCGCACGACTCGGGAGAAAGAGCCAACCTGGAG
CAGGCCGGCCTGCGTGGTCTGCTACGGGTGATCAGCAGTGAACATCCGATGCTGCGCACC
ACCTTGATCGATGTGGACGAACACACGGACGTTGAGCGGGTGGCCCAGCAGCTGCTGAGC
GGATCGGAAGAGGACGAGACGGCCTGGCGGAATGGCGACTGGTATGTGGCCCGCTTGACC
CCCAGTCCGCTGGGCCATGAAGAGCGGCGCACCGCGGTCTTGGATCCCGACCACGACGGT
ATGCGGGTGCAGGTCCGCAGGCCGGGAGACTTGCAAACGTTGGAATTCGTTGCGAGTGAC
CGAGTTCCGCCCGGCCCCGGGCAAATCGAAGTCGCGGTCAGCATGTCCAGCATCAACTTC
GCCGACGTTTTGATCGCGTTTGGACGATTCCCCATTATCGATGACCGCGAGCCGCAGTTG
GGTATGGATTTCGTCGGTGTGGTGACTGCGGTCGGGGAAGGTGTCACCGGTCACCAGGTC
GGTGATCGTGTTGGCGGTTTCTCCGAAGGTGGCTGTTGGCGGACGTTCCTCACCTGTGAC
GCCAACCTCGCGGTCACGCTGCCGCCCGGCTTGACCGATGAGCAGGCGATCACGGCGGCC
ACCGCGCATGCCACCGCCTGGTATGGGCTCAACGACCTGGCTCAGATCAAGGCCGGTGAC
AAAGTGTTGATTCACTCCGCCACCGGCGGTGTGGGGCAGGCGGCCATATCGATTGCCCGC
GCCAAGGGAGCGGAGATTTTCGCGACCGCCGGCAATCCCGCGAAGCGAGCCATGCTGCGC
GACATGGGCGTCGAGCATGTCTACGATTCGCGCAGCGTCGAGTTCGCCGAGCAGATCCGG
CGCGACACCGACGGGTACGGCGTGGATATCGTGCTGAACTCGCTGACCGGCGCCGCCCAA
CGTGCGGGGCTGGAGTTGTTGGCCTTCGGCGGACGCTTCGTCGAAATCGGCAAGGCCGAC
GTTTACGGCAACACCCGGCTGGGGCTGTTCCCGTTCCGTCGCGGACTGACCTTCTACTAC
TTGGACCTCGCGCTGATGTCGGTCACCCAGCCCGACCGGGTCCGTGAGTTGCTGGCCACG
GTGTTCAAGCTCACCGCAGACGGGGTGCTGACCGCACCGCAATGCACTCATTACCCGTTG
GCCGAGGCGGCCGACGCCATCCGGGCAATGAGCAACGCCGAGCACACCGGCAAACTCGTG
CTCGACGTACCGCGTAGCGGCCGTAGAAGCGTGGCGGTCACCCCGGAGCAAGCTCCGCTG
TACCGCCGCGACGGCTCCTACATCATCACCGGCGGCCTGGGTGGCCTCGGCCTGTTCTTC
GCCTCGAAGCTGGCCGCGGCGGGCTGTGGCCGGATCGTGCTGACCGCACGTTCCCAGCCC
AACCCCAAAGCGCGGCAGACCATCGAAGGCCTGCGCGCGGCTGGGGCCGACATCGTGGTG
GAGTGTGGCAACATCGCCGAACCCGACACGGCGGACCGGCTGGTGAGTGCGGCGACCGCT
ACCGGGCTTCCGCTGCGCGGTGTGCTGCACTCGGCGGCGGTGGTCGAGGATGCCACGCTG
ACCAACATCACCGATGAGCTCATCGATCGCGACTGGTCGCCCAAGGTGTTCGGATCCTGG
AACCTACACCGCGCCACCCTCGGTCAGCCGCTGGACTGGTTCTGCTTGTTCTCCTCGGGA
GCGGCATTGCTCGGCTCGCCGGGTCAGGGCGCCTACGCGGCGGCCAACAGCTGGGTCGAC
GTCTTCGCGCACTGGCGCCGCGCCCAGGGCCTGCCGGTCAGCGCGATTGCGTGGGGTGCG
TGGGGCGAGGTCGGCCGCGCCACGTTCTTGGCCGAGGGGGGCGAAATCATGATCACCCCG
GAGGAAGGTGCGTATGCCTTCGAGACGCTCGTGCGCCACGACCGCGCCTACAGCGGTTAC
ATTCCGATCCTCGGGGCGCCATGGCTGGCCGACCTTGTCCGACGCAGCCCGTGGGGTGAA
ATGTTCGCATCCACTGGGCAGCGGTCAAGGGGCCCAAGCAAATTCCGCATGGAGCTCCTT
TCGCTGCCGCAAGATGAATGGGCCGGCCGGCTACGGCGTCTGCTGGTTGAGCAGGCCAGT
GTGATCCTGCGTCGCACGATCGACGCTGACCGCTCATTCATCGAGTACGGCCTGGATTCG
CTGGGCATGCTCGAGATGCGTACCCACGTTGAAACCGAGACCGGGATACGCCTGACCCCC
AAGGTCATCGCCACAAACAACACCGCCCGCGCTTTGGCCCAGTACTTGGCGGACACGCTG
GCCGAGGAGCAGGCGGCGGCACCGGCGGCATCATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:FASm340 fatty acid synthase - octa-methyl tetracontatricosanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm340 fatty acid synthase - octa-methyl tetracontatricosanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm340 fatty acid synthase - octa-methyl tetracontatricosanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm340 fatty acid synthase - octa-methyl tetracontatricosanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm340 fatty acid synthase - octa-methyl tetracontatricosanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm340 fatty acid synthase - octa-methyl tetracontatricosanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm320 fatty acid synthase - hepta-methyl dotriacontanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm320 fatty acid synthase - hepta-methyl dotriacontanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm320 fatty acid synthase - hepta-methyl dotriacontanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm320 fatty acid synthase - hepta-methyl dotriacontanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm320 fatty acid synthase - hepta-methyl dotriacontanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm320 fatty acid synthase - hepta-methyl dotriacontanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm300 fatty acid synthase - hexa-methyl triacontanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm300 fatty acid synthase - hexa-methyl triacontanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm300 fatty acid synthase - hexa-methyl triacontanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm300 fatty acid synthase - hexa-methyl triacontanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm300 fatty acid synthase - hexa-methyl triacontanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm300 fatty acid synthase - hexa-methyl triacontanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm2802 fatty acid synthase - penta-methyl octacosanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2802 fatty acid synthase - penta-methyl octacosanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2802 fatty acid synthase - penta-methyl octacosanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm2802 fatty acid synthase - penta-methyl octacosanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2802 fatty acid synthase - penta-methyl octacosanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2802 fatty acid synthase - penta-methyl octacosanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm280 fatty acid synthase - tetra-methyl octacosanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm280 fatty acid synthase - tetra-methyl octacosanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm280 fatty acid synthase - tetra-methyl octacosanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm280 fatty acid synthase - tetra-methyl octacosanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm280 fatty acid synthase - tetra-methyl octacosanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm280 fatty acid synthase - tetra-methyl octacosanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm2602 fatty acid synthase - tetra-methyl hexacosanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2602 fatty acid synthase - tetra-methyl hexacosanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2602 fatty acid synthase - tetra-methyl hexacosanoic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm2602 fatty acid synthase - tetra-methyl hexacosanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2602 fatty acid synthase - tetra-methyl hexacosanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2602 fatty acid synthase - tetra-methyl hexacosanoic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm260 fatty acid synthase - tri-methyl cerotic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm260 fatty acid synthase - tri-methyl cerotic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm260 fatty acid synthase - tri-methyl cerotic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm260 fatty acid synthase - tri-methyl cerotic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm260 fatty acid synthase - tri-methyl cerotic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm260 fatty acid synthase - tri-methyl cerotic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm2402 fatty acid synthase - tri-methyl-lignoceric acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2402 fatty acid synthase - tri-methyl-lignoceric acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2402 fatty acid synthase - tri-methyl-lignoceric acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm2402 fatty acid synthase - tri-methyl-lignoceric acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2402 fatty acid synthase - tri-methyl-lignoceric acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2402 fatty acid synthase - tri-methyl-lignoceric acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm240 fatty acid synthase - di-methyl lignoceric acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm240 fatty acid synthase - di-methyl lignoceric acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm240 fatty acid synthase - di-methyl lignoceric acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm240 fatty acid synthase - di-methyl lignoceric acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm240 fatty acid synthase - di-methyl lignoceric acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm240 fatty acid synthase - di-methyl lignoceric acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm2202 fatty acid synthase - di-methyl-behenic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2202 fatty acid synthase - di-methyl-behenic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2202 fatty acid synthase - di-methyl-behenic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm2202 fatty acid synthase - di-methyl-behenic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2202 fatty acid synthase - di-methyl-behenic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm2202 fatty acid synthase - di-methyl-behenic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm220 fatty acid synthase - methyl-behenic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm220 fatty acid synthase - methyl-behenic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm220 fatty acid synthase - methyl-behenic acid - ISS	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Term	TBRXN:FASm220 fatty acid synthase - methyl-behenic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm220 fatty acid synthase - methyl-behenic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Term	TBRXN:FASm220 fatty acid synthase - methyl-behenic acid - IDA	active	njamshidi	2012-10-05
	See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Interaction	PhysicalInteraction Rv2941	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) AM. Fitzmaurice & PE. Kolattukudy An acyl-CoA synthase (acoas) gene adjacent to the mycocerosic acid synthase (mas) locus is necessary for mycocerosyl lipid synthesis in Mycobacterium tuberculosis var. bovis BCG. J. Biol. Chem. 1998
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Name	Mycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids	active	mjackson	2012-10-05
	Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Name	Mycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids	active	mjackson	2012-10-05
	Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Mycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic) OA. Trivedi, P. Arora et al. Dissecting the mechanism and assembly of a complex virulence mycobacterial lipid. Mol. Cell 2005
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Mycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guérin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Mycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,AK. Azad,TD. Sirakova,LM. Rogers,PE. Kolattukudy Targeted replacement of the mycocerosic acid synthase gene in Mycobacterium bovis BCG produces a mutant that lacks mycosides. Proc. Natl. Acad. Sci. U.S.A. 1996
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Mycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic) M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Mycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,DL. Rainwater,PE. Kolattukudy Synthesis of mycocerosic acids from methylmalonyl coenzyme A by cell-free extracts of Mycobacterium tuberculosis var. bovis BCG. J. Biol. Chem. 1983