Rv0470c - mycolic acid synthase pcaA

Expression: Most Significant Conditions for Rv0470c

Protein Domains

Gene Information
Locus	Rv0470c
Symbol	pcaA
Gene Name	mycolic acid synthase pcaA
Location	560848 - 561711 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:864 bp Protein:288 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	34018
Related Genes	MAP3963 MAP3964c MAV_4679 MAV_4680 ML2459 MSMEG_0902 MSMEG_0913 MT0486 MT0673 MUL_4538 MUL_4539 Mvan_0803 Rv0469 Rv0645c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0470c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0470c Transcript 1
MSVQLTPHFGNVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKL
NLEPGMTLLDIGCGWGATMRRAIEKYDVNVVGLTLSENQAGHVQKMFDQMDTPRSRRVLL
EGWEKFDEPVDRIVSIGAFEHFGHQRYHHFFEVTHRTLPADGKMLLHTIVRPTFKEGREK
GLTLTHELVHFTKFILAEIFPGGWLPSIPTVHEYAEKVGFRVTAVQSLQLHYARTLDMWA
TALEANKDQAIAIQSQTVYDRYMKYLTGCAKLFRQGYTDVDQFTLEK*

Genomic Sequence

>Rv0470c
ATGTCCGTGCAGCTCACGCCGCATTTTGGAAACGTGCAAGCTCATTACGACCTCTCCGAC
GACTTTTTCCGGCTGTTCTTGGACCCCACCCAGACCTACAGCTGTGCCTACTTCGAACGC
GACGACATGACGCTGCAGGAGGCCCAGATCGCCAAGATCGACCTGGCCCTGGGCAAGCTG
AACCTCGAACCCGGGATGACGTTGCTGGACATCGGCTGCGGCTGGGGCGCGACCATGCGG
CGCGCCATCGAGAAATACGACGTCAATGTCGTGGGCCTGACGTTGTCGGAGAACCAGGCC
GGTCATGTCCAGAAAATGTTCGACCAAATGGACACCCCCCGCTCCAGACGAGTGTTGCTG
GAGGGATGGGAGAAATTTGACGAGCCCGTCGACCGCATCGTCTCGATCGGCGCGTTCGAG
CACTTCGGCCACCAGCGCTACCACCATTTCTTCGAGGTGACCCACCGCACGTTGCCGGCC
GACGGCAAGATGTTGCTGCACACCATCGTGCGCCCCACCTTCAAAGAAGGCAGGGAAAAG
GGCCTGACGTTGACCCACGAACTGGTTCACTTCACCAAATTCATCCTGGCCGAGATCTTC
CCCGGTGGCTGGCTGCCGTCCATCCCGACGGTGCACGAGTACGCCGAGAAGGTCGGCTTC
CGGGTCACCGCGGTCCAGTCATTGCAGCTGCACTACGCCAGGACGCTGGACATGTGGGCC
ACAGCGCTCGAGGCCAACAAAGATCAGGCCATCGCGATCCAGTCGCAGACTGTCTACGAC
CGCTACATGAAGTACCTGACCGGCTGCGCGAAGCTGTTCCGCCAGGGTTACACCGACGTC
GACCAGTTCACACTGGAAAAGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:MYC1CYC3 Mycolic Acid Cyclopropanation - ISS	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:MYC1CYC3 Mycolic Acid Cyclopropanation - IDA	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:MYC1CYC2 Mycolic Acid Cyclopropanation - ISS	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:MYC1CYC2 Mycolic Acid Cyclopropanation - IDA	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:MYC1CYC1 Mycolic Acid Cyclopropanation - ISS	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Term	TBRXN:MYC1CYC1 Mycolic Acid Cyclopropanation - IDA	active	njamshidi	2012-10-05
	PMID: 16356931 F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	RegulatedBy Rv1395	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Name	PcaA (UmaA2) MYCOLIC ACID SYNTHASE PCAA; adds the cyclopropane rings to the proximal positions of the alpha mycolate	active	mjackson	2012-10-05
	S-adenosyl-methionine-dependent mycolic acid methyltransferases
Term	EC:2.1.1.79 Cyclopropane-fatty-acyl-phospholipid synthase. - NR	active	extern:JZUCKER	2012-03-06
	Reaction blocked in mutant MS. Glickman, JS. Cox et al. A novel mycolic acid cyclopropane synthetase is required for cording, persistence, and virulence of Mycobacterium tuberculosis. Mol. Cell 2000
Term	EC:2.1.1.- Transferases. Transferring one-carbon groups. Methyltransferases. - NR	active	extern:JZUCKER	2012-03-06
	Reaction blocked in mutant MS. Glickman, JS. Cox et al. A novel mycolic acid cyclopropane synthetase is required for cording, persistence, and virulence of Mycobacterium tuberculosis. Mol. Cell 2000