Rv1306 - ATP synthase B chain atpF

Expression: Most Significant Conditions for Rv1306

Protein Domains

Gene Information
Locus	Rv1306
Symbol	atpF
Gene Name	ATP synthase B chain atpF
Location	1461321 - 1461836 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:516 bp Protein:172 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	34131
Related Genes	CE1311 CE1312 cg1364 cg1365 DIP1048 DIP1049 jk1338 jk1339 MAP2454c MAP2455c MAV_1523 MAV_1524 Mkms_3953 Mkms_3954 ML1141 ML1142 Mmcs_3879 Mmcs_3880 MSMEG_4939 MSMEG_4940 MT1346 MT1347 MUL_3957 MUL_3958 Mvan_4331 Mvan_4332 nfa10610 nfa10620 Rv1307
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1306
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1306 Transcript 1
MGEVSAIVLAASQAAEEGGESSNFLIPNGTFFVVLAIFLVVLAVIGTFVVPPILKVLRER
DAMVAKTLADNKKSDEQFAAAQADYDEAMTEARVQASSLRDNARADGRKVIEDARVRAEQ
QVASTLQTAHEQLKRERDAVELDLRAHVGTMSATLASRILGVDLTASAATR*

Genomic Sequence

>Rv1306
ATGGGTGAAGTGAGCGCGATTGTCCTGGCCGCCAGTCAGGCGGCAGAGGAAGGCGGCGAG
TCCAGCAACTTCCTCATTCCCAACGGCACGTTTTTCGTTGTGCTGGCCATCTTCCTGGTG
GTGCTCGCTGTCATTGGCACTTTCGTGGTGCCGCCGATCTTGAAGGTCTTGCGGGAACGT
GACGCTATGGTCGCCAAAACGCTGGCCGACAACAAGAAGTCGGACGAGCAGTTCGCCGCC
GCACAGGCCGATTACGACGAAGCCATGACGGAAGCCCGAGTCCAGGCGTCGTCCTTGCGC
GACAATGCCCGGGCAGATGGCCGTAAAGTCATCGAGGACGCACGCGTCCGGGCCGAACAA
CAGGTGGCATCGACGTTGCAGACCGCCCATGAGCAATTGAAGCGGGAGAGGGACGCCGTG
GAACTCGATCTGCGTGCCCACGTGGGCACCATGTCGGCGACTCTGGCCAGTCGAATTCTC
GGTGTTGACCTCACCGCTTCAGCCGCGACGAGGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis authors,M. Rappas,H. Niwa,X. Zhang Mechanisms of ATPases--a multi-disciplinary approach. Curr. Protein Pept. Sci. 2004
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis authors,M. Rappas,H. Niwa,X. Zhang Mechanisms of ATPases--a multi-disciplinary approach. Curr. Protein Pept. Sci. 2004
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy authors,M. Rappas,H. Niwa,X. Zhang Mechanisms of ATPases--a multi-disciplinary approach. Curr. Protein Pept. Sci. 2004
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy authors,M. Rappas,H. Niwa,X. Zhang Mechanisms of ATPases--a multi-disciplinary approach. Curr. Protein Pept. Sci. 2004
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001