Rv1354c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1354c

Protein Domains

Gene Information
Locus	Rv1354c
Symbol
Gene Name	conserved hypothetical protein
Location	1520005 - 1521876 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1872 bp Protein:624 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	26880
Related Genes	cg1179 MAP2361 MAP2511 MAP2512 MAV_1410 MAV_1619 ML1750 ML1752 MT1397 MT1400 MT1410 MUL_3853 Mvan_2109 Rv1357c Rv1364c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1354c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1354c Transcript 1
MCNDTATPQLEELVTTVANQLMTVDAATSAEVSQRVLAYLVEQLGVDVSFLRHNDRDRRA
TRLVAEWPPRLNIPDPDPLRLIYFADADPVFALCEHAKEPLVFRPEPATEDYQRLIEEAR
GVPVTSAAAVPLVSGEITTGLLGFIKFGDRKWHEAELNALMTIATLFAQVQARVAAEARL
RYLADHDDLTGLHNRRALLQHLDQRLAPGQPGPVAALFLDLDRLKAINDYLGHAAGDQFI
HVFAQRIGDALVGESLIARLGGDEFVLIPASPMSADAAQPLAERLRDQLKDHVAIGGEVL
TRTVSIGVASGTPGQHTPSDLLRRADQAALAAKHAGGDSVAIFTADMSVSGELRNDIELH
LRRGIESDALRLVYLPEVDLRTGDIVGTEALVRWQHPTRGLLAPGCFIPVAESINLAGEL
DRWVLRRACNEFSEWQSAGLGHDALLRINVSAGQLVTGGFVDFVADTIGQHGLDASSVCL
EITENVVVQDLHTARATLARLKEVGVHIAIDDFGTGYSAISLLQTLPIDTLKIDKTFVRQ
LGTNTSDLVIVRGIMTLAEGFQLDVVAEGVETEAAARILLDQRCYRAQGFLFSRPVPGEA
MRHMLSARRLPPTCIPATDPALS*

Genomic Sequence

>Rv1354c
ATGTGCAACGACACCGCGACGCCGCAGCTTGAGGAGCTCGTCACCACCGTAGCCAACCAG
CTCATGACAGTCGACGCTGCCACGTCAGCCGAAGTCAGTCAGCGCGTTTTGGCCTATCTA
GTGGAACAGCTGGGCGTAGATGTCAGCTTTTTGCGTCATAACGATCGCGACAGGCGCGCG
ACGAGGCTGGTGGCCGAATGGCCACCTCGCCTCAACATACCGGACCCCGATCCGCTCAGG
CTGATCTACTTCGCTGATGCCGACCCGGTGTTTGCGCTATGCGAACACGCCAAAGAGCCT
CTCGTGTTCCGGCCCGAGCCGGCCACCGAGGACTATCAACGCCTCATCGAAGAAGCCCGC
GGGGTTCCGGTAACGTCGGCTGCCGCCGTGCCGCTGGTATCTGGCGAGATCACCACTGGA
CTGCTGGGGTTCATCAAGTTCGGTGATCGGAAATGGCACGAGGCCGAGCTTAACGCCCTC
ATGACCATCGCTACACTCTTCGCCCAGGTGCAGGCTCGCGTCGCCGCCGAGGCGCGGCTT
CGCTATCTGGCCGACCATGACGATCTGACCGGACTGCATAACCGTCGCGCGTTGCTGCAG
CACCTGGACCAAAGACTGGCCCCCGGACAACCTGGCCCGGTCGCGGCGCTATTTCTCGAC
TTGGACCGCCTCAAGGCCATCAACGACTACCTGGGCCACGCCGCCGGTGACCAGTTCATC
CATGTGTTCGCCCAACGGATCGGTGACGCACTCGTTGGCGAGAGCCTGATCGCCCGACTC
GGCGGCGACGAATTCGTCCTCATACCCGCATCTCCAATGAGTGCCGATGCCGCTCAACCG
CTCGCCGAACGTCTTCGCGACCAGCTCAAGGACCACGTCGCTATCGGCGGTGAGGTGCTC
ACCCGCACCGTCAGTATCGGTGTCGCCTCAGGGACTCCCGGACAGCACACACCGTCGGAC
CTCCTGCGCCGAGCCGACCAAGCCGCTCTGGCAGCCAAACACGCCGGCGGAGATAGCGTC
GCGATTTTCACCGCGGACATGTCGGTCAGCGGCGAACTGCGCAACGATATTGAACTACAC
CTTCGACGTGGTATCGAATCCGACGCCCTTCGCCTGGTCTACCTACCCGAGGTCGACCTA
CGGACCGGCGACATTGTCGGGACCGAGGCATTGGTCCGGTGGCAGCACCCCACCCGTGGG
CTGCTGGCACCGGGCTGCTTCATCCCTGTGGCCGAATCCATCAACCTTGCAGGCGAATTG
GATAGATGGGTGCTGCGGAGGGCCTGCAATGAATTCTCCGAGTGGCAGTCAGCCGGTTTG
GGCCACGACGCGCTGCTGCGTATCAACGTCTCAGCTGGACAGCTGGTGACGGGCGGGTTT
GTTGACTTCGTCGCAGACACGATCGGCCAGCACGGTCTGGACGCCTCGTCCGTGTGTTTG
GAAATCACCGAAAACGTTGTGGTGCAAGACCTACATACCGCCAGAGCCACCCTGGCTCGA
CTCAAAGAAGTCGGCGTTCACATCGCTATCGACGATTTCGGCACCGGCTATAGCGCCATA
TCACTGTTGCAGACGCTACCGATCGACACGCTCAAGATCGACAAAACATTCGTGCGGCAA
CTCGGAACCAACACTAGCGATCTGGTCATTGTGCGCGGCATCATGACACTCGCCGAAGGC
TTCCAACTCGATGTAGTAGCCGAAGGCGTCGAGACCGAGGCTGCCGCCAGAATTCTATTG
GATCAGCGCTGTTACCGTGCGCAAGGCTTCTTGTTCTCCCGGCCTGTCCCCGGGGAGGCC
ATGCGGCACATGTTGTCCGCACGACGACTACCGCCGACCTGCATACCTGCAACTGACCCG
GCGTTATCTTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv1357c	active	swetha.r	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv0820	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv0665	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv3102c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv3663c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv0986	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv3758c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv1281c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv2397c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv2832c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv0073	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv2936	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv0933	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv1238	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv2038c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv1859	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv2564	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv1687c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv1747	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv0350	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv1357c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv0981	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv1420	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Signaling Rv3080c	active	swetha.r	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009