Rv1405c - methyltransferase

Expression: Most Significant Conditions for Rv1405c

Protein Domains

Gene Information
Locus	Rv1405c
Symbol
Gene Name	methyltransferase
Location	1581145 - 1581969 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:825 bp Protein:275 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	26698
Related Genes	MAP1132c MAV_3373 ML0551 MT1447 MT1449 MUL_1798 MUL_1801 Rv1403c SAV4411 SAV4412
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1405c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1405c Transcript 1
MTIDTPAREDQTLAATHRAMWALGDYALMAEEVMAPLGPILVAAAGIGPGVRVLDVAAGS
GNISLPAAKTGATVISTDLTPELLQRSQARAAQQGLTLQYQEANAQALPFADDEFDTVIS
AIGVMFAPDHQAAADELVRVCRPGGTIGVISWTCEGFFGRMLATIRPYRPSVSADLPPSA
LWGREAYVTGLLGDGVTGLKTARGLLEVKRFDTAQAVHDYFKNNYGPTIEAYAHIGDNAV
LAAELDRQLVELAAQYLSDGVMEWEYLLLTAEKR*

Genomic Sequence

>Rv1405c
ATGACTATCGACACACCTGCTCGCGAGGACCAAACGCTTGCGGCCACACACCGGGCGATG
TGGGCCCTGGGTGACTACGCCCTGATGGCAGAAGAGGTGATGGCGCCACTCGGCCCGATC
CTGGTTGCCGCCGCGGGCATCGGGCCGGGTGTTCGGGTGCTCGACGTCGCCGCTGGCTCT
GGCAATATTTCGCTGCCCGCAGCCAAGACGGGTGCCACGGTCATTTCCACCGACCTGACG
CCCGAGCTGCTGCAGCGGTCCCAGGCCAGGGCCGCCCAACAGGGGCTGACCCTGCAATAC
CAGGAAGCCAACGCGCAAGCCCTGCCGTTTGCCGACGACGAGTTCGACACGGTGATCTCA
GCGATCGGCGTGATGTTCGCACCGGATCATCAGGCCGCGGCCGACGAGCTGGTCCGCGTC
TGCCGGCCTGGCGGGACGATCGGTGTGATCAGCTGGACGTGCGAGGGATTCTTCGGCCGG
ATGCTGGCAACCATTAGGCCATACCGGCCCAGCGTGTCGGCGGATCTGCCGCCGTCGGCG
TTGTGGGGACGTGAGGCCTATGTCACTGGTCTGCTGGGCGATGGAGTCACTGGCCTCAAG
ACGGCCCGTGGCTTGTTGGAAGTGAAGCGGTTCGACACCGCCCAGGCCGTCCACGACTAC
TTCAAGAACAACTATGGCCCGACGATCGAGGCCTACGCGCACATCGGTGACAACGCGGTG
CTGGCCGCCGAGCTCGACCGCCAGCTTGTCGAACTCGCAGCGCAATACCTGTCGGACGGT
GTCATGGAATGGGAGTACCTGCTGCTCACCGCCGAAAAGCGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Regulatory Rv1403c	active	ashwinigbhat	2012-10-05
	P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1403c	active	ashwinigbhat	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	Regulatory Rv1403c	active	ashwinigbhat	2012-10-05
	authors,KH. Rohde,RB. Abramovitch,DG. Russell Mycobacterium tuberculosis invasion of macrophages: linking bacterial gene expression to environmental cues. Cell Host Microbe 2007
Interaction	Regulatory Rv1403c	active	priti.priety	2012-10-05
	P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1403c	active	priti.priety	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	Regulatory Rv1403c	active	priti.priety	2012-10-05
	authors,KH. Rohde,RB. Abramovitch,DG. Russell Mycobacterium tuberculosis invasion of macrophages: linking bacterial gene expression to environmental cues. Cell Host Microbe 2007
Interaction	Regulatory Rv1404	active	ashwinigbhat	2012-10-05
	qRT-PCR P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1403c	active	ashwinigbhat	2012-10-05
	P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1403c	active	ashwinigbhat	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	Regulatory Rv1403c	active	ashwinigbhat	2012-10-05
	authors,KH. Rohde,RB. Abramovitch,DG. Russell Mycobacterium tuberculosis invasion of macrophages: linking bacterial gene expression to environmental cues. Cell Host Microbe 2007
Interaction	Regulatory Rv1403c	active	priti.priety	2012-10-05
	P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1403c	active	priti.priety	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	Regulatory Rv1403c	active	priti.priety	2012-10-05
	authors,KH. Rohde,RB. Abramovitch,DG. Russell Mycobacterium tuberculosis invasion of macrophages: linking bacterial gene expression to environmental cues. Cell Host Microbe 2007
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008