Rv2377c - hypothetical protein mbtH

Expression: Most Significant Conditions for Rv2377c

Protein Domains

Gene Information
Locus	Rv2377c
Symbol	mbtH
Gene Name	hypothetical protein mbtH
Location	2656215 - 2656430 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:216 bp Protein:72 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	20217
Related Genes	MAP2169c MAV_2016 Mkms_3526 Mmcs_3463 MSMEG_4508 MUL_3639 Mvan_3842 SAV851
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2377c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2377c Transcript 1
MSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLR
PKSLRDAMVED*

Genomic Sequence

>Rv2377c
GTGAGCACCAATCCTTTCGATGACGACAACGGCGCATTCTTCGTGCTGGTCAACGACGAA
GACCAGCACAGCCTGTGGCCGGTGTTCGCCGATATCCCGGCCGGCTGGCGCGTGGTGCAC
GGCGAAGCCAGCCGTGCCGCCTGCCTGGACTACGTGGAAAAGAACTGGACCGATCTGCGG
CCGAAGAGCCTGCGTGACGCCATGGTCGAGGACTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2711	active	chirupolo	2012-10-05
	Co-expression (Functional linkage) LE. Quadri, J. Sello et al. Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. Chem. Biol. 1998
Interaction	Regulatory Rv2711	active	chirupolo	2012-10-05
	Co-expression (Functional linkage) GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002