Rv2557 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2557

Protein Domains

Gene Information
Locus	Rv2557
Symbol
Gene Name	conserved hypothetical protein
Location	2877072 - 2877746 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:675 bp Protein:225 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	4060
Related Genes	MAP1074c MAP1075c MAV_3433 Mkms_2391 Mmcs_2344 MT2634 MT2635 MUL_1752 Mvan_4767 Rv2558
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2557
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2557 Transcript 1
MTGGATGALPRTMKEGWIVYARSTTIQAQSECIDTGIAHVRDVVMPALQGMDGCIGVSLL
VDRQSGRCIATSAWETAEAMHASREQVTPIRDRCAEMFGGTPAVEEWEIAAMHRDHRSAE
GACVRATWVKVPADQVDQGIEYYKSSVLPQIEGLDGFCSASLLVDRTSGRAVSSATFDSF
DAMERNRDQSNALKATSLREAGGEELDECEFELALAHLRVPELV*

Genomic Sequence

>Rv2557
TTGACCGGTGGCGCCACCGGGGCGCTGCCCCGAACAATGAAAGAGGGGTGGATCGTGTAC
GCGCGCTCTACCACTATTCAGGCGCAATCCGAGTGCATCGACACCGGAATTGCGCACGTT
CGCGATGTGGTTATGCCCGCACTGCAGGGGATGGATGGGTGCATCGGCGTATCCCTTTTG
GTCGACCGGCAATCCGGCAGGTGCATCGCCACCAGTGCCTGGGAGACCGCGGAAGCCATG
CATGCAAGCCGGGAACAGGTAACGCCGATCCGCGATCGGTGCGCGGAGATGTTCGGCGGC
ACGCCGGCCGTCGAGGAGTGGGAGATCGCGGCGATGCATCGCGACCACCGCTCGGCCGAG
GGGGCGTGTGTGCGGGCGACCTGGGTCAAGGTGCCGGCGGACCAAGTAGATCAAGGCATC
GAGTACTACAAGTCGTCCGTCCTGCCCCAAATCGAAGGCCTCGACGGATTCTGCAGCGCC
AGCCTGTTGGTCGACCGCACCTCCGGGCGCGCGGTGTCTTCCGCGACCTTCGACAGCTTT
GACGCCATGGAGCGCAACCGGGACCAGTCGAATGCGCTCAAGGCCACATCGCTGCGTGAG
GCGGGCGGCGAGGAACTCGATGAATGCGAGTTCGAGCTGGCGCTAGCGCACCTACGGGTA
CCCGAGCTGGTCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2558	active	gaurisd10	2012-10-05
	Structural Analysis A. Luthra, SS. Malik et al. Cloning, purification and comparative structural analysis of two hypothetical proteins from Mycobacterium tuberculosis found in the human granuloma during persistence and highly up-regulated under carbon-starvation conditions. Protein Expr. Purif. 2008
Interaction	Regulatory Rv2558	active	gaurisd10	2012-10-05
	Structural Analysis G. Fenhalls, L. Stevens et al. In situ detection of Mycobacterium tuberculosis transcripts in human lung granulomas reveals differential gene expression in necrotic lesions. Infect. Immun. 2002
Interaction	Regulatory Rv2558	active	gaurisd10	2012-10-05
	Structural Analysis BG. Gordhan, DA. Smith et al. The carbon starvation-inducible genes Rv2557 and Rv2558 of Mycobacterium tuberculosis are not required for long-term survival under carbon starvation and for virulence in SCID mice. Tuberculosis (Edinburgh, Scotland) 2006
Interaction	Regulatory Rv2558	active	gaurisd10	2012-10-05
	Spectrophotometric A. Luthra, SS. Malik et al. Cloning, purification and comparative structural analysis of two hypothetical proteins from Mycobacterium tuberculosis found in the human granuloma during persistence and highly up-regulated under carbon-starvation conditions. Protein Expr. Purif. 2008
Interaction	Regulatory Rv2558	active	gaurisd10	2012-10-05
	Spectrophotometric G. Fenhalls, L. Stevens et al. In situ detection of Mycobacterium tuberculosis transcripts in human lung granulomas reveals differential gene expression in necrotic lesions. Infect. Immun. 2002
Interaction	Regulatory Rv2558	active	gaurisd10	2012-10-05
	Spectrophotometric BG. Gordhan, DA. Smith et al. The carbon starvation-inducible genes Rv2557 and Rv2558 of Mycobacterium tuberculosis are not required for long-term survival under carbon starvation and for virulence in SCID mice. Tuberculosis (Edinburgh, Scotland) 2006
Interaction	Regulatory Rv2558	active	gaurisd10	2012-10-05
	Structural Analysis A. Luthra, SS. Malik et al. Cloning, purification and comparative structural analysis of two hypothetical proteins from Mycobacterium tuberculosis found in the human granuloma during persistence and highly up-regulated under carbon-starvation conditions. Protein Expr. Purif. 2008
Interaction	Regulatory Rv2558	active	gaurisd10	2012-10-05
	Structural Analysis G. Fenhalls, L. Stevens et al. In situ detection of Mycobacterium tuberculosis transcripts in human lung granulomas reveals differential gene expression in necrotic lesions. Infect. Immun. 2002
Interaction	Regulatory Rv2558	active	gaurisd10	2012-10-05
	Structural Analysis BG. Gordhan, DA. Smith et al. The carbon starvation-inducible genes Rv2557 and Rv2558 of Mycobacterium tuberculosis are not required for long-term survival under carbon starvation and for virulence in SCID mice. Tuberculosis (Edinburgh, Scotland) 2006
Interaction	Regulatory Rv2558	active	gaurisd10	2012-10-05
	Spectrophotometric A. Luthra, SS. Malik et al. Cloning, purification and comparative structural analysis of two hypothetical proteins from Mycobacterium tuberculosis found in the human granuloma during persistence and highly up-regulated under carbon-starvation conditions. Protein Expr. Purif. 2008
Interaction	Regulatory Rv2558	active	gaurisd10	2012-10-05
	Spectrophotometric G. Fenhalls, L. Stevens et al. In situ detection of Mycobacterium tuberculosis transcripts in human lung granulomas reveals differential gene expression in necrotic lesions. Infect. Immun. 2002
Interaction	Regulatory Rv2558	active	gaurisd10	2012-10-05
	Spectrophotometric BG. Gordhan, DA. Smith et al. The carbon starvation-inducible genes Rv2557 and Rv2558 of Mycobacterium tuberculosis are not required for long-term survival under carbon starvation and for virulence in SCID mice. Tuberculosis (Edinburgh, Scotland) 2006
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009