Rv2638 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2638

Protein Domains

Gene Information
Locus	Rv2638
Symbol
Gene Name	conserved hypothetical protein
Location	2964405 - 2964851 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:447 bp Protein:149 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	20701
Related Genes	MAP2742 MAV_3518 MT1955 MT2716 MUL_2925 MUL_3282 nfa24330 Rv1904 SAV2058
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2638
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2638 Transcript 1
MGLITTEPRSSPHPLSPRLVHELGDPHSTLRATTDGSGAALLIHAGGEIDGRNEHLWRQL
VTEAAAGVTAPGPLIVDVTGLDFMGCCAFAALADEAQRCRCRGIDLRLVSHQPIVARIAE
AGGLSRVLPIYPTVDTALGKGTAGPARC*

Genomic Sequence

>Rv2638
ATGGGCCTGATCACTACAGAACCACGCTCTAGTCCCCACCCGCTCAGCCCACGGCTCGTC
CACGAGCTAGGCGACCCACACAGCACGCTGCGGGCAACCACTGACGGCAGCGGGGCAGCG
TTGTTGATCCACGCGGGCGGCGAGATCGATGGCCGCAACGAGCATCTCTGGCGTCAATTG
GTCACCGAGGCCGCCGCCGGCGTCACGGCGCCCGGACCGCTCATCGTCGACGTCACCGGG
CTCGATTTCATGGGCTGCTGCGCTTTCGCCGCACTGGCCGACGAGGCACAACGATGTCGG
TGCCGCGGCATCGACCTGCGTCTGGTGAGCCACCAGCCGATCGTCGCCCGGATCGCCGAA
GCGGGTGGGCTGAGCCGAGTGCTGCCCATCTACCCGACCGTCGATACTGCGCTCGGCAAG
GGCACGGCCGGTCCAGCCCGTTGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Signaling Rv3287c	active	priya.bdu07	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Signaling Rv3286c	active	priya.bdu07	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv0516c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv0516c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
Interaction	Regulatory Rv0516c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003