Rv2930 - fatty-acid-CoA ligase fadD26

Expression: Most Significant Conditions for Rv2930

Protein Domains

Gene Information
Locus	Rv2930
Symbol	fadD26
Gene Name	fatty-acid-CoA ligase fadD26
Location	3243697 - 3245448 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1752 bp Protein:584 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	25808
Related Genes	Mkms_2878 Mkms_2879 ML2356 ML2357 ML2358 Mmcs_2834 Mmcs_2835 MSMEG_6767 MT2999 MT3000 MT3002 MT3003 MUL_2018 MUL_2019 MUL_2020 Mvan_3125 Mvan_3126 Mvan_3128 Rv2931 Rv2932 Rv2933
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2930
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2930 Transcript 1
MPVTDRSVPSLLQERADQQPDSTAYTYIDYGSDPKGFADSLTWSQVYSRACIIAEELKLC
GLPGDRVAVLAPQGLEYVLAFLGALQAGFIAVPLSTPQYGIHDDRVSAVLQDSKPVAILT
TSSVVGDVTKYAASHDGQPAPVVVEVDLLDLDSPRQMPAFSRQHTGAAYLQYTSGSTRTP
AGVIVSHTNVIANVTQSMYGYFGDPAKIPTGTVVSWLPLYHDMGLILGICAPLVARRRAM
LMSPMSFLRRPARWMQLLATSGRCFSAAPNFAFELAVRRTSDQDMAGLDLRDVVGIVSGS
ERIHVATVRRFIERFAPYNLSPTAIRPSYGLAEATLYVAAPEAGAAPKTVRFDYEQLTAG
QARPCGTDGSVGTELISYGSPDPSSVRIVNPETMVENPPGVVGEIWVHGDHVTMGYWQKP
KQTAQVFDAKLVDPAPAAPEGPWLRTGDLGVISDGELFIMGRIKDLLIVDGRNHYPDDIE
ATIQEITGGRAAAIAVPDDITEQLVAIIEFKRRGSTAEEVMLKLRSVKREVTSAISKSHS
LRVADLVLVSPGSIPITTSGKIRRSACVERYRSDGFKRLDVAV*

Genomic Sequence

>Rv2930
ATGCCGGTGACCGACCGTTCAGTGCCCTCTTTGCTGCAAGAGAGGGCCGACCAGCAGCCT
GACAGCACTGCATATACGTACATCGACTACGGATCCGACCCCAAGGGATTTGCTGACAGC
TTGACTTGGTCGCAGGTCTACAGTCGTGCATGCATCATTGCTGAAGAACTCAAGTTATGC
GGGTTACCCGGAGATCGAGTGGCGGTTTTAGCGCCACAAGGACTGGAATATGTCCTTGCA
TTCCTGGGCGCACTTCAGGCTGGATTTATCGCGGTTCCGCTGTCAACTCCACAGTATGGC
ATTCACGATGACCGCGTTTCTGCGGTGTTGCAGGATTCCAAGCCGGTAGCCATTCTCACG
ACTTCGTCCGTGGTAGGCGATGTAACGAAATACGCAGCCAGCCACGACGGGCAGCCTGCC
CCGGTCGTAGTTGAGGTTGATCTGCTTGATTTGGACTCGCCGCGACAGATGCCGGCTTTC
TCTCGTCAGCACACCGGGGCGGCTTATCTCCAATACACGTCCGGATCGACGCGTACGCCG
GCCGGAGTCATTGTGTCGCACACGAATGTCATTGCCAATGTGACACAAAGTATGTACGGC
TATTTCGGCGATCCCGCAAAGATTCCGACCGGGACTGTGGTGTCGTGGCTGCCTTTGTAT
CACGATATGGGCCTGATTCTCGGAATTTGCGCACCGCTGGTGGCCCGACGCCGCGCGATG
TTGATGAGCCCAATGTCATTTTTGCGCCGTCCGGCCCGCTGGATGCAACTGCTTGCCACC
AGCGGCCGGTGCTTTTCTGCGGCACCGAATTTCGCCTTCGAGCTGGCCGTGCGCAGAACA
TCTGACCAGGACATGGCGGGGCTCGACCTGCGCGACGTGGTCGGCATCGTCAGTGGCAGT
GAGCGAATCCATGTGGCAACCGTGCGGCGGTTCATCGAGCGGTTCGCGCCGTACAATCTC
AGCCCCACCGCGATACGGCCGTCGTACGGGCTCGCGGAAGCGACCTTATATGTGGCAGCT
CCCGAAGCCGGCGCCGCGCCCAAGACGGTCCGTTTTGACTACGAGCAGCTGACCGCCGGG
CAGGCTCGGCCCTGCGGAACCGATGGGTCGGTCGGCACCGAACTGATCAGCTACGGCTCC
CCCGACCCATCGTCTGTGCGAATCGTCAACCCGGAGACCATGGTTGAGAATCCGCCTGGA
GTGGTCGGTGAGATCTGGGTGCATGGCGACCACGTGACTATGGGGTATTGGCAGAAGCCG
AAGCAGACCGCGCAGGTCTTCGACGCCAAGCTGGTCGATCCCGCGCCGGCAGCCCCGGAG
GGGCCGTGGCTGCGCACCGGCGACCTGGGCGTCATTTCCGATGGTGAGCTGTTCATCATG
GGCCGCATCAAAGACCTGCTCATCGTGGACGGGCGCAACCACTACCCCGACGACATCGAG
GCAACGATCCAGGAGATCACCGGTGGACGGGCCGCGGCGATCGCAGTGCCCGACGACATC
ACCGAACAACTGGTGGCGATCATCGAATTCAAGCGACGCGGTAGTACCGCCGAAGAGGTC
ATGCTCAAGCTCCGCTCGGTGAAGCGTGAGGTCACCTCCGCGATATCGAAGTCACACAGC
CTGCGGGTGGCCGATCTCGTTCTGGTGTCACCTGGTTCGATTCCCATCACCACCAGCGGC
AAGATCCGGCGGTCAGCCTGCGTCGAACGCTATCGCAGCGACGGCTTCAAGCGGCTGGAC
GTAGCCGTATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:FACOALPREPH fatty-acid--CoA ligase (phthiocerol precursor) - ISS	active	njamshidi	2012-10-05
	see PMID: 15292265 E. Pérez, P. Constant et al. Molecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
Term	TBRXN:FACOALPREPH fatty-acid--CoA ligase (phthiocerol precursor) - IDA	active	njamshidi	2012-10-05
	see PMID: 15292265 E. Pérez, P. Constant et al. Molecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2939	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2939	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2935	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2935	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2934	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2934	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2933	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2933	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2932	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2932	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2931	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2931	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2939	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2938	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2937	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2936	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2935	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2934	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2933	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2932	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2931	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2939	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2938	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2937	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2936	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2935	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2934	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2933	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2932	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2931	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	Regulatory Rv3692	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv3416	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2745c	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2034	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv0445c	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv0117	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv3692	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3416	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2745c	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2034	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv0445c	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv0117	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3692	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2745c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1956	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1359	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0117	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Name	Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates	active	mjackson	2012-10-05
	Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains]) OA. Trivedi, P. Arora et al. Dissecting the mechanism and assembly of a complex virulence mycobacterial lipid. Mol. Cell 2005
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains]) OA. Trivedi,P. Arora,V. Sridharan,R. Tickoo,D. Mohanty,RS. Gokhale Enzymic activation and transfer of fatty acids as acyl-adenylates in mycobacteria. Nature 2004
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains]) authors,R. Siméone,M. Léger,P. Constant,W. Malaga,H. Marrakchi,M. Daffé,C. Guilhot,C. Chalut Delineation of the roles of FadD22, FadD26 and FadD29 in the biosynthesis of phthiocerol dimycocerosates and related compounds in Mycobacterium tuberculosis. FEBS J. 2010
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains]) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Term	EC:6.2.1.3 Long-chain-fatty-acid--CoA ligase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002