Rv3134c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv3134c

Protein Domains

Gene Information
Locus	Rv3134c
Symbol
Gene Name	conserved hypothetical protein
Location	3499943 - 3500749 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:807 bp Protein:269 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	35089
Related Genes	cg1595 MAP3179c MAV_4010 Mkms_4202 Mkms_5069 Mmcs_4127 Mmcs_4981 MSMEG_5245 MT2698 MT3220 MUL_2424 MUL_3267 Mvan_2549 Rv2623
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3134c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3134c Transcript 1
MSDPRPARAVVVGIDGSRAATHAALWAVDEAVNRDIPLRLVYVIDPSQLSAAGEGGGQSA
ARAALHDASRKVEATGQPVKIETEVLCGRPLTKLMQESRSAAMLCVGSVGLDHVRGRRGS
VAATLAGSALCPVAVIHPSPAEPATTSQVSAVVAEVDNGVVLRHAFEEARLRGVPLRAVA
VHAAETPDDVEQGSRLAHVHLSRRLAHWTRLYPEVRVDRAIAGGSACRHLAANAKPGQLF
VADSHSAHELCGAYQPGCAVLTVRSANL*

Genomic Sequence

>Rv3134c
ATGAGCGATCCTCGGCCAGCTCGGGCAGTGGTCGTTGGTATCGACGGGTCAAGGGCGGCA
ACGCATGCGGCGTTGTGGGCGGTCGATGAGGCGGTGAACCGAGACATTCCGCTGCGACTG
GTGTACGTCATCGATCCGTCCCAACTGTCCGCCGCCGGCGAGGGCGGTGGGCAATCAGCG
GCCCGAGCGGCGCTGCACGACGCCTCTCGGAAGGTCGAGGCCACCGGGCAACCGGTCAAG
ATCGAAACGGAGGTTCTGTGCGGCAGGCCGCTCACCAAGCTGATGCAGGAGTCCAGGTCC
GCGGCGATGCTGTGCGTCGGTTCGGTGGGGCTTGATCATGTCCGCGGTCGCCGGGGTTCG
GTCGCGGCGACCCTGGCTGGGTCGGCCTTATGCCCCGTGGCGGTGATTCACCCGTCGCCG
GCCGAGCCAGCGACAACCTCCCAGGTCAGCGCGGTTGTCGCGGAGGTGGACAATGGTGTG
GTGCTGCGGCACGCATTCGAGGAGGCCAGGCTGCGCGGAGTTCCGCTGCGGGCCGTGGCT
GTCCACGCTGCTGAAACACCCGATGACGTCGAACAGGGCAGCCGGTTGGCGCATGTACAC
CTGAGCCGTCGGCTCGCCCACTGGACCCGGCTCTACCCCGAGGTGCGGGTGGATCGGGCC
ATCGCCGGCGGCAGTGCGTGCCGTCATCTGGCCGCCAACGCAAAGCCGGGTCAGCTGTTC
GTCGCGGACTCACACTCCGCGCACGAATTGTGCGGTGCATACCAGCCCGGATGCGCCGTA
CTTACGGTACGCAGTGCCAACTTGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3133c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) G. Bagchi, null. Mayuri et al. Hypoxia-responsive expression of Mycobacterium tuberculosis Rv3134c and devR promoters in Mycobacterium smegmatis. Microbiology (Reading, Engl.) 2003
Interaction	PhysicalInteraction Rv3132c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) G. Bagchi, null. Mayuri et al. Hypoxia-responsive expression of Mycobacterium tuberculosis Rv3134c and devR promoters in Mycobacterium smegmatis. Microbiology (Reading, Engl.) 2003
Interaction	PhysicalInteraction Rv3133c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) JG. Rodriguez, CS. Burbano et al. Rv3134c/devR/devS operon of Mycobacterium bovis BCG is differentially transcribed under "in vitro" stress conditions. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	PhysicalInteraction Rv3132c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) JG. Rodriguez, CS. Burbano et al. Rv3134c/devR/devS operon of Mycobacterium bovis BCG is differentially transcribed under "in vitro" stress conditions. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	PhysicalInteraction Rv3133c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	PhysicalInteraction Rv3132c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	PhysicalInteraction Rv3133c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	PhysicalInteraction Rv3132c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	PhysicalInteraction Rv3133c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) S. Chauhan & JS. Tyagi Cooperative binding of phosphorylated DevR to upstream sites is necessary and sufficient for activation of the Rv3134c-devRS operon in Mycobacterium tuberculosis: implication in the induction of DevR target genes. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv3132c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) S. Chauhan & JS. Tyagi Cooperative binding of phosphorylated DevR to upstream sites is necessary and sufficient for activation of the Rv3134c-devRS operon in Mycobacterium tuberculosis: implication in the induction of DevR target genes. J. Bacteriol. 2008
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv3833	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3692	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2669	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2017	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008