Rv3544c - acyl-CoA dehydrogenase fadE28

Expression: Most Significant Conditions for Rv3544c

Protein Domains

Gene Information
Locus	Rv3544c
Symbol	fadE28
Gene Name	acyl-CoA dehydrogenase fadE28
Location	3983125 - 3984144 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1020 bp Protein:340 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	21442
Related Genes	MAP0523 MAV_0617 Mkms_4762 Mmcs_4676 MSMEG_5994 MT3648 MUL_4105 Mvan_5257 nfa4490
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3544c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3544c Transcript 1
MDFDPTAEQQAVADVVTSVLERDISWEALVCGGVTALPVPERLGGDGVGLFEVGALLTEV
GRHGAVTPALATLGLGVVPLLELASAEQQDRFLAGVAKGGVLTAALNEPGAALPDRPATS
FVGGRLSGTKVGVGYAEQADWMLVTADNAVVVVSPTADGVRMVRTPTSNGSDEYVMTMDG
VAVADCDILADVAAHRVNQLALAVMGAYADGLVAGALRLTADYVANRKQFGKPLSTFQTV
AAQLAEVYIASRTIDLVAKSVIWRLAEDLDAGDDLGVLGYWVTSQAPPAMQICHHLHGGM
GMDVTYPMHRYYSTIKDLTRLLGGPSHRLELLGARCSLT*

Genomic Sequence

>Rv3544c
ATGGATTTCGATCCCACTGCGGAACAGCAAGCCGTCGCCGACGTGGTCACGTCGGTGTTG
GAGCGGGACATCTCGTGGGAGGCGCTGGTCTGCGGTGGTGTGACGGCGCTGCCGGTGCCG
GAACGTCTCGGCGGCGACGGCGTGGGCCTATTCGAAGTCGGCGCGCTGCTCACCGAGGTG
GGTCGCCACGGCGCCGTCACGCCGGCGCTGGCAACGCTGGGTCTTGGGGTGGTGCCGCTG
CTCGAGCTGGCATCCGCCGAGCAACAGGACCGCTTCCTGGCCGGGGTGGCCAAGGGAGGA
GTACTGACCGCCGCGCTCAACGAGCCCGGGGCGGCGCTGCCGGATCGGCCTGCCACTAGC
TTTGTGGGTGGGCGGTTGTCGGGCACCAAAGTCGGTGTTGGCTACGCCGAACAGGCGGAC
TGGATGTTGGTGACCGCCGACAACGCCGTCGTGGTGGTGTCGCCGACGGCCGACGGTGTG
CGCATGGTTCGTACGCCCACATCGAATGGTTCAGACGAGTATGTGATGACGATGGACGGC
GTGGCGGTTGCCGACTGTGACATCCTGGCGGATGTAGCCGCGCACCGGGTCAATCAGCTA
GCGCTGGCCGTCATGGGTGCATACGCCGACGGGCTGGTCGCCGGGGCGCTGCGGCTGACC
GCCGACTACGTGGCGAACCGGAAGCAGTTCGGTAAGCCGCTGTCAACCTTCCAGACCGTG
GCCGCGCAGCTCGCCGAGGTTTACATCGCCTCGCGCACCATTGACCTGGTGGCCAAGTCG
GTGATCTGGAGACTGGCCGAGGATCTGGATGCGGGAGATGATCTGGGCGTCCTCGGGTAC
TGGGTGACATCGCAGGCGCCGCCGGCGATGCAAATCTGCCATCACCTGCACGGCGGCATG
GGGATGGACGTCACGTATCCGATGCACCGCTACTACTCCACGATCAAGGACCTCACCCGG
CTGCTGGGCGGGCCCTCGCATCGCCTTGAGCTCCTGGGAGCGCGATGTTCATTGACCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	Regulatory Rv3416	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2034	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2017	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv1956	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv0818	active	jgalag	2012-10-05
	bacterial one-hybrid system M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3574	active	jgalag	2012-10-05
	Co-expression (Functional linkage) authors,R. Van der Geize,K. Yam,T. Heuser,MH. Wilbrink,H. Hara,MC. Anderton,E. Sim,L. Dijkhuizen,JE. Davies,WW. Mohn,LD. Eltis A gene cluster encoding cholesterol catabolism in a soil actinomycete provides insight into Mycobacterium tuberculosis survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3574	active	jgalag	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2034	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2017	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1956	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0818	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	M.smegmatis orthology based inference. Orthologous pair regulator-target found in M.smegmatis. SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Term	EC:1.3.99.- Oxidoreductases. Acting on the CH-CH group of donors. With other acceptors. - NR	active	nsampson	2012-03-05
	Assay of protein purified to homogeneity from a heterlogous host authors,ST. Thomas,BC. VanderVen,DR. Sherman,DG. Russell,NS. Sampson Pathway profiling in Mycobacterium tuberculosis: elucidation of cholesterol-derived catabolite and enzymes that catalyze its metabolism. J. Biol. Chem. 2011
Other	product:2	active	rslayden	2012-03-05
	enzyme is a heterodimer, digit four of EC number not yet assigned authors,ST. Thomas,BC. VanderVen,DR. Sherman,DG. Russell,NS. Sampson Pathway profiling in Mycobacterium tuberculosis: elucidation of cholesterol-derived catabolite and enzymes that catalyze its metabolism. J. Biol. Chem. 2011
Term	EC:1.3.99.- Oxidoreductases. Acting on the CH-CH group of donors. With other acceptors. - NR	active	rslayden	2012-03-05
	enzyme is a heterodimer, digit four of EC number not yet assigned authors,ST. Thomas,BC. VanderVen,DR. Sherman,DG. Russell,NS. Sampson Pathway profiling in Mycobacterium tuberculosis: elucidation of cholesterol-derived catabolite and enzymes that catalyze its metabolism. J. Biol. Chem. 2011
Symbol	FadE28	active	rslayden	2012-03-05
	enzyme is a heterodimer, digit four of EC number not yet assigned authors,ST. Thomas,BC. VanderVen,DR. Sherman,DG. Russell,NS. Sampson Pathway profiling in Mycobacterium tuberculosis: elucidation of cholesterol-derived catabolite and enzymes that catalyze its metabolism. J. Biol. Chem. 2011
Name	Acyl-CoA Dehydrogenase	active	cstolte	2011-01-03
	Not directly confirmed as part of beta-oxidation, and could be other isozymes
Symbol	FadE28	active	cstolte	2011-01-03
	Not directly confirmed as part of beta-oxidation, and could be other isozymes
Name	Acyl-CoA Dehydrogenase	active	jgalag	2010-09-02
	Not directly confirmed as part of beta-oxidation, and could be other isozymes
Symbol	FadE28	active	jgalag	2010-09-02
	Not directly confirmed as part of beta-oxidation, and could be other isozymes