Rv1180 - polyketide beta-ketoacyl synthase pks3

Expression: Most Significant Conditions for Rv1180

Protein Domains

Gene Information
Locus	Rv1180
Symbol	pks3
Gene Name	polyketide beta-ketoacyl synthase pks3
Location	1313725 - 1315191 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1467 bp Protein:489 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	31305
Related Genes	ML1229 MT1218 Rv1181
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1180
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1180 Transcript 1
MRTATATSVAVIGMACRLPGGIDSPQRLWEALLRGDDLVGEIPADRWDANVYYDPEPGVP
GRSVSRWGAFLDDVGGFDCDFFGLTEREATAIDPQHRLLLEVSWEAIEHAGVDPATLAES
QTGVFVGLTHGDYELLSADCGAAEGPYGFTGTSNSFASGRVAYTLGLHGPAVTVDTACSS
GLTAVHQACRSLDDGESDLALAGGVVVTLEPRKSVSGSLQGMLSPTGRCHAFDEAADGFV
SGEGCVVLLLKRLPDAVRDGDRVLAIVRGTAANQDGRTVNIAAPSAQAQIAVYQQALAAA
GVEASTVGMVEAHGTGTPVGDPVEYASLAAVYGTEGPCALTSVKTNFGHLQSASGPLGLM
KTILALRHGVVPQNLHFCRLPDQLAEIDTELFVPQANTSWPDNTGQPRRAAVSSYGMSGT
NVHAILEQAPVSEPAASGPELTPEAGGLALFPVSATSAEQLHVTAARLADWVDQNGNAGS
RVSMRDLG*

Genomic Sequence

>Rv1180
GTGCGCACCGCAACCGCCACATCGGTCGCCGTTATCGGCATGGCTTGCCGGCTCCCGGGC
GGCATCGATTCCCCACAACGCCTCTGGGAAGCGCTGTTACGCGGCGACGATTTGGTGGGT
GAGATTCCCGCTGACCGGTGGGACGCGAACGTGTACTACGACCCCGAACCTGGTGTCCCT
GGTCGATCGGTATCGCGTTGGGGCGCCTTTCTGGACGACGTCGGCGGGTTTGACTGCGAT
TTCTTCGGCCTGACCGAGCGGGAGGCGACCGCGATCGACCCACAGCACCGCTTGCTGCTG
GAAGTGTCGTGGGAGGCTATCGAGCACGCGGGTGTGGACCCGGCGACGCTCGCTGAATCA
CAAACAGGTGTCTTCGTAGGACTGACACACGGCGACTACGAGCTGCTGTCCGCGGATTGC
GGCGCCGCGGAAGGACCGTACGGATTCACCGGCACCAGTAACAGTTTCGCGTCCGGGCGA
GTGGCCTACACACTCGGACTGCATGGCCCCGCGGTCACGGTGGACACCGCGTGCTCGTCC
GGGTTGACGGCTGTGCATCAAGCCTGCCGCAGCCTGGATGACGGTGAAAGCGATCTCGCT
CTTGCCGGTGGTGTGGTTGTCACGCTAGAACCGCGGAAGTCCGTCTCGGGTTCCCTGCAA
GGCATGTTGTCGCCTACCGGGCGTTGCCATGCCTTCGACGAAGCAGCTGATGGCTTCGTG
TCCGGTGAGGGGTGCGTGGTCCTGCTGCTGAAGCGGCTACCGGATGCGGTGCGCGACGGT
GATCGTGTGCTGGCGATCGTTCGTGGCACCGCAGCCAACCAGGATGGCCGCACCGTGAAT
ATCGCGGCGCCGTCGGCGCAGGCTCAGATCGCGGTGTATCAGCAAGCGTTGGCTGCAGCG
GGCGTCGAAGCGTCGACGGTGGGGATGGTCGAAGCCCACGGCACCGGCACCCCCGTTGGA
GATCCGGTCGAATACGCGAGCCTGGCCGCGGTGTACGGAACCGAGGGTCCGTGCGCGCTG
ACGTCGGTGAAAACAAACTTCGGTCACCTGCAGTCGGCATCGGGGCCCCTGGGGTTGATG
AAGACAATCCTGGCGTTGCGGCATGGGGTTGTGCCGCAGAACCTGCACTTCTGCCGGCTG
CCTGATCAGCTGGCTGAGATTGACACTGAACTCTTTGTGCCGCAAGCGAATACATCCTGG
CCGGACAACACCGGACAGCCACGTCGCGCTGCGGTTTCCTCGTATGGAATGTCGGGTACC
AACGTGCATGCCATCTTGGAGCAAGCGCCGGTATCAGAACCAGCGGCTTCGGGACCTGAG
CTCACTCCCGAAGCCGGTGGGCTGGCGTTGTTTCCGGTGTCGGCTACCTCGGCTGAGCAA
CTACACGTCACGGCCGCCCGGCTGGCGGATTGGGTCGACCAGAACGGCAACGCGGGCAGT
CGAGTTAGCATGCGGGACCTGGGCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Name	Together with Pks4, polyketide synthase involved in the synthesis of mycolipenic and mycosanoic acids	active	mjackson	2012-10-05
	Polymethyl-branched acyltrehaloses
Other	TBPWY:Polymethyl-branched acyltrehaloses	active	mjackson	2012-03-05
	Together with Pks4, polyketide synthase involved in the synthesis of mycolipenic and mycosanoic acids (phenotypic [mycobacterial recombinant strains]) authors,C. Rousseau,O. Neyrolles,Y. Bordat,S. Giroux,TD. Sirakova,MC. Prevost,PE. Kolattukudy,B. Gicquel,M. Jackson Deficiency in mycolipenate- and mycosanoate-derived acyltrehaloses enhances early interactions of Mycobacterium tuberculosis with host cells. Cell. Microbiol. 2003
Other	TBPWY:Polymethyl-branched acyltrehaloses	active	mjackson	2012-03-05
	Together with Pks4, polyketide synthase involved in the synthesis of mycolipenic and mycosanoic acids (phenotypic [mycobacterial recombinant strains]) VS. Dubey, TD. Sirakova et al. Disruption of msl3 abolishes the synthesis of mycolipanoic and mycolipenic acids required for polyacyltrehalose synthesis in Mycobacterium tuberculosis H37Rv and causes cell aggregation. Mol. Microbiol. 2002
Other	EC:	active	jjmcfadden	2012-03-05
	Inferred from direct assay VS. Dubey, TD. Sirakova et al. Disruption of msl3 abolishes the synthesis of mycolipanoic and mycolipenic acids required for polyacyltrehalose synthesis in Mycobacterium tuberculosis H37Rv and causes cell aggregation. Mol. Microbiol. 2002