Rv1788 - PE family protein

Expression: Most Significant Conditions for Rv1788

Protein Domains

Gene Information
Locus	Rv1788
Symbol	PE18
Gene Name	PE family protein
Location	2026477 - 2026776 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:300 bp Protein:100 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11498
Related Genes	MAP1507 MAV_2923 MT1837 MT1840 MUL_3084 MUL_3088 Rv1791
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1788
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1788 Transcript 1
MSFVTTQPEALAAAAGSLQGIGSALNAQNAAAATPTTGVVPAAADEVSALTAAQFAAHAQ
IYQAVSAQAAAIHEMFVNTLQMSSGSYAATEAANAAAAG*

Genomic Sequence

>Rv1788
ATGTCGTTTGTGACTACCCAACCAGAAGCACTGGCGGCGGCGGCCGGCAGTCTGCAGGGA
ATCGGCTCCGCATTGAACGCCCAGAATGCGGCTGCGGCGACTCCCACGACGGGGGTGGTC
CCGGCGGCCGCCGATGAAGTGTCGGCGCTGACGGCGGCTCAGTTCGCGGCACACGCCCAG
ATCTATCAGGCCGTCAGCGCCCAGGCCGCGGCGATTCACGAGATGTTCGTCAACACTCTA
CAGATGAGCTCAGGGTCGTATGCTGCTACCGAGGCCGCCAACGCGGCCGCGGCCGGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1789	active	gaat3s	2012-10-05
	Operon (Functional linkage) authors,R. Riley,M. Pellegrini,D. Eisenberg Identifying cognate binding pairs among a large set of paralogs: the case of PE/PPE proteins of Mycobacterium tuberculosis. PLoS Comput. Biol. 2008
Interaction	PhysicalInteraction Rv1789	active	gaat3s	2012-10-05
	Operon (Functional linkage) S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Interaction	PhysicalInteraction Rv1787	active	akankshajain.21	2012-10-05
	S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Interaction	PhysicalInteraction Rv1787	active	akankshajain.21	2012-10-05
	authors,SS. Jha,L. Danelishvili,D. Wagner,J. Maser,YJ. Li,I. Moric,S. Vogt,Y. Yamazaki,B. Lai,LE. Bermudez Virulence-related Mycobacterium avium subsp hominissuis MAV_2928 gene is associated with vacuole remodeling in macrophages. BMC Microbiol. 2010
Interaction	PhysicalInteraction Rv1787	active	akankshajain.21	2012-10-05
	S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Symbol	PPE25-PE19	active	jlew	2012-03-07
	Mutant is defective in ESXN and PPE41 secretion. Mutant is attenuated in macrophages and SCID mice. authors,D. Bottai,M. Di Luca,L. Majlessi,W. Frigui,R. Simeone,F. Sayes,W. Bitter,MJ. Brennan,C. Leclerc,G. Batoni,M. Campa,R. Brosch,S. Esin Disruption of the ESX-5 system of Mycobacterium tuberculosis causes loss of PPE protein secretion, reduction of cell wall integrity and strong attenuation. Molecular microbiology 2012